GENSCAN 1.0	Date run: 21-Nov-103	Time: 06:36:32

Sequence HS307871 : 4514 bp : 52.19% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:


Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    739    851  113  0  2   49   66    74 0.287   0.98
 1.02 Intr +   1748   1860  113  2  2   53  110    80 0.866   7.23
 1.03 Intr +   1976   2055   80  0  2   97   94    10 0.999   2.27
 1.04 Intr +   2132   2194   63  1  0   84   80    87 0.990   6.91
 1.05 Intr +   2434   2631  198  0  0   88   -9   263 0.895  16.67
 1.06 Intr +   2749   2910  162  0  0  107  109    97 0.965  14.39
 1.07 Intr +   3279   3416  138  2  0   52   77   126 0.812   9.07
 1.08 Intr +   3576   3676  101  2  2   87  119   113 0.996  13.71
 1.09 Intr +   3780   3846   67  0  1   63   77    46 0.998   0.40
 1.10 Term +   4179   4340  162  2  0   75   47   276 0.979  20.45
 1.11 PlyA +   4397   4402    6                               1.05

Predicted peptide sequence(s):


>HS307871|GENSCAN_predicted_peptide_1|398_aa
VQAIVWTWLDKTVGIIVGTCAKLRIPRLSDENKFLMSPPQGFPELKNDTFLRAAWGEETD
YTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFLLDAAIIFSDILV
VPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRV
PLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVA
GAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFAL
EELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFG
PHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN


Explanation

Gn.Ex : gene number, exon number (for reference)
Type  : Init = Initial exon (ATG to 5' splice site)
        Intr = Internal exon (3' splice site to 5' splice site)
        Term = Terminal exon (3' splice site to stop codon)
        Sngl = Single-exon gene (ATG to stop)
        Prom = Promoter (TATA box / initation site)
        PlyA = poly-A signal (consensus: AATAAA)
S     : DNA strand (+ = input strand; - = opposite strand)
Begin : beginning of exon or signal (numbered on input strand)
End   : end point of exon or signal (numbered on input strand)
Len   : length of exon or signal (bp)
Fr    : reading frame (a forward strand codon ending at x has frame x mod 3)
Ph    : net phase of exon (exon length modulo 3)
I/Ac  : initiation signal or 3' splice site score (tenth bit units)
Do/T  : 5' splice site or termination signal score (tenth bit units)
CodRg : coding region score (tenth bit units)
P     : probability of exon (sum over all parses containing exon)
Tscr  : exon score (depends on length, I/Ac, Do/T and CodRg scores)

Comments

The SCORE of a predicted feature (e.g., exon or splice site) is a
log-odds measure of the quality of the feature based on local sequence
properties. For example, a predicted 5' splice site with
score > 100 is strong; 50-100 is moderate; 0-50 is weak; and
below 0 is poor (more than likely not a real donor site).

The PROBABILITY of a predicted exon is the estimated probability under
GENSCAN's model of genomic sequence structure that the exon is correct.
This probability depends in general on global as well as local sequence
properties, e.g., it depends on how well the exon fits with neighboring
exons.  It has been shown that predicted exons with higher probabilities
are more likely to be correct than those with lower probabilities.