TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000632_2.0 # Protein # 15 kDa selenoprotein (Sel15) # Zebrafish Length=146 Score E Sequences producing significant alignments: (Bits) Value ML171018.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 88.2 8e-20 >ML171018.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold15, whole genome shotgun sequence Length=9088374 Score = 88.2 bits (217), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%) Frame = +2 Query 102 IKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI 146 ++YVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL+RI Sbjct 7705688 LQYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLDRI 7705822 Score = 47.8 bits (112), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 0/58 (0%) Frame = +2 Query 9 QLASYGAELSSEACRELGFssnllcsscellGQFSLNQLDLPCRQCCQEEAQLENRKL 66 QL++YGA+L+SEACR+LGFSSNLLCSSC+LLG+FSLN+L C+QCCQ+EAQ+E RK+ Sbjct 7702022 QLSAYGADLTSEACRDLGFSSNLLCSSCDLLGEFSLNKLQPDCQQCCQQEAQMEARKV 7702195 Score = 43.1 bits (100), Expect = 4e-04, Method: Composition-based stats. Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%) Frame = +2 Query 65 KLYPGAILEVCGXKLGRFPQVQA 87 +LY GAILEVCG KLGRFPQVQ Sbjct 7704821 QLYAGAILEVCG*KLGRFPQVQG 7704889 Lambda K H a alpha 0.322 0.140 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 7513931140 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40