TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000648_2.0 # Protein # Selenoprotein S (SELENOS) # Zebrafish Length=190 Score E Sequences producing significant alignments: (Bits) Value ML171169.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 50.8 7e-13 >ML171169.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold166, whole genome shotgun sequence Length=316150 Score = 50.8 bits (120), Expect(2) = 7e-13, Method: Compositional matrix adjust. Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%) Frame = -1 Query 110 EEEKRRQKIEMWDSMQEGKSYKGSAKVAQ 138 EEEKRRQKIE+WDSMQ+G+SYKG+AK +Q Sbjct 41425 EEEKRRQKIEIWDSMQQGRSYKGTAKPSQ 41339 Score = 43.5 bits (101), Expect(2) = 7e-13, Method: Compositional matrix adjust. Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%) Frame = -3 Query 73 DVGSVVRRQEALEASRRRMQEEQDARAAEFREKQRMLE 110 D V +RQEA+EA+R +MQEE DA+A FREKQR ++ Sbjct 41615 DAALVAKRQEAMEAARIKMQEELDAKADIFREKQRQVQ 41502 Score = 41.6 bits (96), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Frame = -1 Query 26 PSVTAFMSEYGWYLLFGCVGVYLLIQHLRK 55 P+V +S+YGWYLL V VYLLIQHL K Sbjct 43351 PTVGELLSQYGWYLLAVTVLVYLLIQHLSK 43262 Lambda K H a alpha 0.312 0.126 0.358 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 15429910640 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40