TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000638_2.0 # Protein # Selenoprotein M (SELENOM) # Zebrafish Length=127 Score E Sequences producing significant alignments: (Bits) Value ML171020.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 75.9 9e-16 ML171012.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 38.5 0.008 >ML171020.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold17, whole genome shotgun sequence Length=8097053 Score = 75.9 bits (185), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%) Frame = -1 Query 81 RIPLSEMTRAEINKLLAELGFYKKDHPEDQVPEEFRFSPAKDSPFE 126 RI LS+M+R+EIN+LL ELGFYKK PE +VPEEFRFSPAKDSPF+ Sbjct 6803273 RIALSDMSRSEINELLGELGFYKKTDPEAEVPEEFRFSPAKDSPFK 6803136 Score = 61.6 bits (148), Expect(2) = 5e-11, Method: Composition-based stats. Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%) Frame = -2 Query 53 LYHNLVMKHIPGADPELVLLNHYYEELD 80 L HNLVMKHIPGADPELVLLNHYYEELD Sbjct 6803965 LSHNLVMKHIPGADPELVLLNHYYEELD 6803882 Score = 24.6 bits (52), Expect(2) = 5e-11, Method: Composition-based stats. Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Frame = -3 Query 42 EVKAFVTQDIPLYHNLVMKH 61 +VKAFV QDIPL + L H Sbjct 6804117 QVKAFVVQDIPL*YPLAHVH 6804058 >ML171012.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold9, whole genome shotgun sequence Length=11052619 Score = 38.5 bits (88), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 0/40 (0%) Frame = +2 Query 82 IPLSEMTRAEINKLLAELGFYKKDHPEDQVPEEFRFSPAK 121 +P+ +M EI+ LL LGFYK+ ++VPEEF+ P + Sbjct 10099646 VPVEKMKAEEISSLLDSLGFYKRSQKGEEVPEEFQHFPLR 10099765 Lambda K H a alpha 0.320 0.139 0.403 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5078873300 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40