TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000633_2.0 # Protein # Selenoprotein K (SELENOK) # Zebrafish Length=94 Score E Sequences producing significant alignments: (Bits) Value ML171008.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 52.4 5e-08 >ML171008.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold5, whole genome shotgun sequence Length=16171435 Score = 52.4 bits (124), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%) Frame = -3 Query 6 NGQVLDSRSRSPWSLSFLTDFFWGAVEFIGLF 37 +G+VLDSRS+SPWSLS+L D FWGAV+F GL Sbjct 15413903 SGRVLDSRSQSPWSLSYLVDLFWGAVDFFGLL 15413808 Lambda K H a alpha 0.322 0.135 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5087796500 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40