TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000615_2.0 # Protein # Fish selenoprotein 15 (SELENOE) # Zebrafish Length=138 Score E Sequences producing significant alignments: (Bits) Value ML171012.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 80.9 2e-17 >ML171012.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold9, whole genome shotgun sequence Length=11052619 Score = 80.9 bits (198), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%) Frame = +2 Query 98 MKADEISSLLDSLGFYKRSEKGEEVPEEFKHFPLRAPRDEL 138 MKA+EISSLLDSLGFYKRS+KGEEVPEEF+HFPLR PRDEL Sbjct 10099661 MKAEEISSLLDSLGFYKRSQKGEEVPEEFQHFPLRPPRDEL 10099783 Score = 47.0 bits (110), Expect = 1e-05, Method: Composition-based stats. Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%) Frame = +3 Query 38 LVAPSVVGXSIKKMPELYNFLMERWAL 64 L APSVVG IKKMPEL++FLMERWAL Sbjct 10098210 LQAPSVVG*GIKKMPELHHFLMERWAL 10098290 Score = 41.6 bits (96), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%) Frame = +2 Query 58 LMERWALYHNLEYDSGEDKNPRLIFYN 84 L+ + HNLEYDS E+KNPRLIFYN Sbjct 10098533 LIPSFLCSHNLEYDSSEEKNPRLIFYN 10098613 Lambda K H a alpha 0.315 0.134 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 6296126412 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40