TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000663_2.0 # Protein # Phosphoseryl-tRNA kinase (PSTK) # Zebrafish Length=205 Score E Sequences producing significant alignments: (Bits) Value ML171007.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 61.2 9e-10 >ML171007.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold4, whole genome shotgun sequence Length=16548284 Score = 61.2 bits (147), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 7/89 (8%) Frame = -2 Query 61 EWKQHRKTVLACLERFLQHSLSEQTHTLPETHTLCEQADAGVWMR-FEQLLRDQSVFLSH 119 EWK HR+ VL C+E+FL+ + LP++ Q + W R + LL+ ++ S Sbjct 6075895 EWKLHRQAVLRCVEQFLEKP--QVLAELPDSR----QINRAAWERCIQALLQPGALDRSQ 6075734 Query 120 THSQPLVLLLDDNFYYQSMRQQIQQLARR 148 PL+ LLDDNFYY SMR ++ QLAR+ Sbjct 6075733 ADQPPLLFLLDDNFYYPSMRYEVYQLARK 6075647 Score = 52.8 bits (125), Expect = 7e-07, Method: Composition-based stats. Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%) Frame = -2 Query 150 TCGFCQVFLQCSLGVCVQRNRLRVRPLPDAVLLQMSERLEPPDSR 194 + GFCQV+LQC L C+ RNR R P+P V+ +M +RLE P+ + Sbjct 6075352 SLGFCQVYLQCDLESCISRNRTRSEPIPTEVISEMVKRLESPNPQ 6075218 Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 0/43 (0%) Frame = -2 Query 12 ACLCLLFGLPAAGKSRLAEQLRGHAHSRGWRTLTVTYDLLIPE 54 ACLC+L GLPAAGKS LA ++ A RGWR V YD LI E Sbjct 6076633 ACLCVLCGLPAAGKSTLAREVLSTAAQRGWRASVVPYDDLILE 6076505 Lambda K H a alpha 0.325 0.135 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 18271289160 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40