TBLASTN 2.7.1+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 10,816 sequences; 612,774,492 total letters Query= SPP00000625_2.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Zebrafish Length=238 Score E Sequences producing significant alignments: (Bits) Value ML171010.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 78.2 3e-15 ML171028.1 Anarrhichthys ocellatus isolate YVR2014 unplaced geno... 75.9 2e-14 >ML171010.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold7, whole genome shotgun sequence Length=13290546 Score = 78.2 bits (191), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%) Frame = -2 Query 183 LSRKGLGEITTDIRQLTVFYYAEDYHQQYLHKVPKGYCGLKGTGVTCSITEGRDEL 238 L +KG G ITT+IR+ +FYYAED HQQYL KVP GYC LKGTGV+C I ++EL Sbjct 6445001 LDKKGYGSITTEIREGQLFYYAEDDHQQYLKKVPNGYCNLKGTGVSCPIGARKEEL 6444834 Score = 77.8 bits (190), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%) Frame = -1 Query 71 GMGCFWGAERRFWKITGVFSTQVGYAGGFTSNPTYHEVCSGLT-GH 115 G+GCFWGAER FW++ GV++TQVG+AGGFT NP YHEVCSG T GH Sbjct 6467814 GLGCFWGAERLFWRLPGVYTTQVGFAGGFTPNPNYHEVCSGDTLGH 6467677 Score = 72.0 bits (175), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%) Frame = -1 Query 108 VCSGLTGHTEVVRVVFSPKDVSLEKLLKVFWESHDPTQG 146 +C GLTGH EVVRVVFSP+DV LE+LLK FWESHDPTQG Sbjct 6464526 LCLGLTGHAEVVRVVFSPEDVGLEELLKRFWESHDPTQG 6464410 Score = 49.7 bits (117), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%) Frame = -3 Query 146 GMAQGNDHGTQYRSAIYTYSPEQQDLAMKSKHMYQE 181 GM Q ND GT YRSAIYT +P QQ+LA+KSK +Q+ Sbjct 6453934 GMRQQNDRGTPYRSAIYTSNPTQQELALKSKVAFQQ 6453827 >ML171028.1 Anarrhichthys ocellatus isolate YVR2014 unplaced genomic scaffold scaffold25, whole genome shotgun sequence Length=6454106 Score = 75.9 bits (185), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%) Frame = -2 Query 69 MFGMGCFWGAERRFWKITGVFSTQVGYAGGFTSNPTYHEVCSG 111 + GMGCFWG ER+FWK GV+STQVGYAGG+T NPTY EVC+G Sbjct 4609120 LVGMGCFWGVERKFWKQKGVYSTQVGYAGGYTPNPTYKEVCTG 4608992 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%) Frame = -3 Query 170 DLAMKSKHMYQEALSRKGLGEITTDIRQLTVFYYAEDYHQQYLHKVPKGYCGLKGTGVTC 229 +L M + + L+ +G ITT+I + FYYAEDYHQQYL K P+GYCGL GTGV+C Sbjct 4579146 NLQMCLCCCFFQVLAEEGYSAITTEIAEAKPFYYAEDYHQQYLSKNPEGYCGLGGTGVSC 4578967 Query 230 SI 231 I Sbjct 4578966 PI 4578961 Score = 56.6 bits (135), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%) Frame = -2 Query 110 SGLTGHTEVVRVVFSPKDVSLEKLLKVFWESHDP 143 +G+TGH EVVRVVF P+ +S LLKVFWESH+P Sbjct 4604851 AGMTGHAEVVRVVFHPEQISFASLLKVFWESHNP 4604750 Lambda K H a alpha 0.319 0.136 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 24562115732 Database: genome.fa Posted date: Oct 26, 2019 7:49 PM Number of letters in database: 612,774,492 Number of sequences in database: 10,816 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40