TBLASTN 2.6.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 3,184 sequences; 1,209,001,349 total letters Query= SPP00001035_2.0 # Protein # Glutathione peroxidase 8 (GPx8) # Chicken Length=123 Score E Sequences producing significant alignments: (Bits) Value PTFA01000055.1 Casuarius casuarius isolate B32419 scaffold_54, w... 179 6e-52 PTFA01000081.1 Casuarius casuarius isolate B32419 scaffold_80, w... 112 2e-28 PTFA01000256.1 Casuarius casuarius isolate B32419 scaffold_255, ... 47.8 9e-06 PTFA01000489.1 Casuarius casuarius isolate B32419 scaffold_488, ... 46.2 3e-05 PTFA01000118.1 Casuarius casuarius isolate B32419 scaffold_117, ... 41.2 0.002 PTFA01000490.1 Casuarius casuarius isolate B32419 scaffold_489, ... 38.9 0.011 PTFA01000063.1 Casuarius casuarius isolate B32419 scaffold_62, w... 32.7 1.7 PTFA01000326.1 Casuarius casuarius isolate B32419 scaffold_325, ... 31.2 4.9 PTFA01000036.1 Casuarius casuarius isolate B32419 scaffold_35, w... 30.4 8.7 >PTFA01000055.1 Casuarius casuarius isolate B32419 scaffold_54, whole genome shotgun sequence Length=5338051 Score = 179 bits (455), Expect = 6e-52, Method: Compositional matrix adjust. Identities = 85/92 (92%), Positives = 89/92 (97%), Gaps = 0/92 (0%) Frame = +1 Query 1 KATLVVNVASYCQHTDKNYIALQDLHREFGPSHFTVLAFPCNQFGESEPGSSQEIEAFAK 60 KATLVVNVASYCQHTDKNYIALQ+LHREFGPSHFTVLAFPCNQFGESEP SSQEIE+FAK Sbjct 2037973 KATLVVNVASYCQHTDKNYIALQELHREFGPSHFTVLAFPCNQFGESEPSSSQEIESFAK 2038152 Query 61 GNYGVTFPVFHKIKILGSEAEPAFKFLRWNFW 92 GNYGVTFPVFHKIKILGSEAEPAFKFL N++ Sbjct 2038153 GNYGVTFPVFHKIKILGSEAEPAFKFLIGNYF 2038248 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%) Frame = +1 Query 80 AEPAFKFLRWNFWKYLVSPEGKVVKFWRpeepiesikpeiASLI 123 A+ + K RWNFWKYLV+PEGKVVKFWRPEEPI +IKPE+ASLI Sbjct 2041090 ADSSKKEPRWNFWKYLVNPEGKVVKFWRPEEPIGTIKPEVASLI 2041221 >PTFA01000081.1 Casuarius casuarius isolate B32419 scaffold_80, whole genome shotgun sequence Length=3960531 Score = 112 bits (281), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 0/85 (0%) Frame = +3 Query 3 TLVVNVASYCQHTDKNYIALQDLHREFGPSHFTVLAFPCNQFGESEPGSSQEIEAFAKGN 62 +LVVNVAS C +TD +Y ALQ L R+ GP HF VLAFPCNQFG+ EP S++EIE+FA+ Sbjct 1168983 SLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSNREIESFARKT 1169162 Query 63 YGVTFPVFHKIKILGSEAEPAFKFL 87 YG +FP+F K + G+ A PAFK+L Sbjct 1169163 YGASFPMFSKTAVSGAGAIPAFKYL 1169237 Score = 37.4 bits (85), Expect = 0.040, Method: Compositional matrix adjust. Identities = 15/18 (83%), Positives = 15/18 (83%), Gaps = 0/18 (0%) Frame = +2 Query 89 WNFWKYLVSPEGKVVKFW 106 WNFWKYLV P GKVVK W Sbjct 1171091 WNFWKYLVDPNGKVVKAW 1171144 >PTFA01000256.1 Casuarius casuarius isolate B32419 scaffold_255, whole genome shotgun sequence Length=1427201 Score = 47.8 bits (112), Expect = 9e-06, Method: Composition-based stats. Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Frame = +3 Query 4 LVVNVASYCQHTDKNYIALQDLHREFGPSHFTVLAFPCNQFGESEPGSS 52 ++ NVAS TD NY L DL+ + +LAFPCNQFG+ GS+ Sbjct 735798 IITNVASK*GKTDVNYTQLVDLYARYAERGLRILAFPCNQFGKQVCGST 735944 >PTFA01000489.1 Casuarius casuarius isolate B32419 scaffold_488, whole genome shotgun sequence Length=288360 Score = 46.2 bits (108), Expect = 3e-05, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Frame = +1 Query 1 KATLVVNVASYCQHTDKNYIALQDLHREFGPSHFTVLAFPCNQFG 45 + LV NVAS T ++++ +L + +GP VL FPCNQFG Sbjct 151981 RVLLVSNVASL*GTTARDFVQFNELQQRYGPRGLVVLGFPCNQFG 152115 >PTFA01000118.1 Casuarius casuarius isolate B32419 scaffold_117, whole genome shotgun sequence Length=3204144 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/34 (53%), Positives = 20/34 (59%), Gaps = 0/34 (0%) Frame = +3 Query 22 LQDLHREFGPSHFTVLAFPCNQFGESEPGSSQEI 55 L L E GP VL FP NQFG+ EPG + EI Sbjct 145992 LNALQNELGPYGLVVLGFPSNQFGKQEPGQNSEI 146093 >PTFA01000490.1 Casuarius casuarius isolate B32419 scaffold_489, whole genome shotgun sequence Length=293072 Score = 38.9 bits (89), Expect = 0.011, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query 1 KATLVVNVASYCQHTDKNYIALQDLHREFGPSHFTVLAFPCNQFG 45 + L+ NVAS T ++Y L L + P VL FPCNQFG Sbjct 150637 RVVLIENVASL*GTTVRDYTQLNQLQARY-PRRLVVLGFPCNQFG 150506 >PTFA01000063.1 Casuarius casuarius isolate B32419 scaffold_62, whole genome shotgun sequence Length=5001589 Score = 32.7 bits (73), Expect = 1.7, Method: Composition-based stats. Identities = 15/41 (37%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Frame = -1 Query 41 CNQFGESEPGSSQEIEAFAKGNYGVTFPVFHKIKILGSEAE 81 CN FG+S PG SQ F + G T P + +L S+ + Sbjct 193033 CNSFGQSLPGLSQMTPGFGASSPGTTVPTGYDHTVLESKTQ 192911 >PTFA01000326.1 Casuarius casuarius isolate B32419 scaffold_325, whole genome shotgun sequence Length=969952 Score = 31.2 bits (69), Expect = 4.9, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (2%) Frame = +1 Query 27 REFGPSHFTVLAFPCNQFGESEP-GSSQEIEAFAKGNYGVTFPVFHKIKILGSEAEPAFK 85 R+ P HF A PC ++ + P G+ +++E +G V+ P F +L E A Sbjct 606604 RKIDPEHFGASAVPCRRYCKPVPSGNGKKMEP*REGRKLVSSPAFCLDLLLALEHTRATP 606783 Query 86 FLR 88 +LR Sbjct 606784 YLR 606792 >PTFA01000036.1 Casuarius casuarius isolate B32419 scaffold_35, whole genome shotgun sequence Length=6593893 Score = 30.4 bits (67), Expect = 8.7, Method: Composition-based stats. Identities = 22/77 (29%), Positives = 37/77 (48%), Gaps = 21/77 (27%) Frame = -2 Query 9 ASYCQHTDKNYIALQDLH----REFGPSHFTVLAFPCNQFGESEPGSSQEIEAFAKGNYG 64 A CQH+ K+ I+ +D H R + P + + +P S Q +EA++KG Sbjct 2049414 AQVCQHSQKSSISSEDFHVSERRVWEPKEAAM---------KPQPLSRQRLEAWSKGK-- 2049268 Query 65 VTFPVFHKIKILGSEAE 81 ++++LGS AE Sbjct 2049267 ------PRVEVLGSGAE 2049235 Lambda K H a alpha 0.322 0.137 0.440 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 10067210425 Database: genome.fa Posted date: Oct 19, 2018 9:06 AM Number of letters in database: 1,209,001,349 Number of sequences in database: 3,184 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40