TBLASTN 2.6.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 3,184 sequences; 1,209,001,349 total letters Query= SPP00000031_1.0 # Protein # Selenoprotein W2 (SelW2) # Homo sapiens # Complete Length=115 Score E Sequences producing significant alignments: (Bits) Value PTFA01000190.1 Casuarius casuarius isolate B32419 scaffold_189, ... 61.2 1e-10 PTFA01000038.1 Casuarius casuarius isolate B32419 scaffold_37, w... 30.8 6.0 >PTFA01000190.1 Casuarius casuarius isolate B32419 scaffold_189, whole genome shotgun sequence Length=1967023 Score = 61.2 bits (147), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%) Frame = +3 Query 31 EPCGFEATYLELASAVKEQYPGIEIESRLGGTG 63 EPCGFE TY ELASAVKE+YP IEIESRLGGTG Sbjct 143433 EPCGFEPTYQELASAVKEEYPDIEIESRLGGTG 143531 Score = 56.6 bits (135), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 26/27 (96%), Positives = 27/27 (100%), Gaps = 0/27 (0%) Frame = +1 Query 63 GAFEIEINGQLVFSKLENGGFPYEKDL 89 GAFEIEINGQLVFSKLENGGFPYEKD+ Sbjct 144073 GAFEIEINGQLVFSKLENGGFPYEKDV 144153 Score = 53.1 bits (126), Expect = 1e-07, Method: Composition-based stats. Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 0/32 (0%) Frame = +3 Query 84 PYEKDLIEAIRRASNGETLEKITNSRPPCVIL 115 P LIEAIRRA NGE LEKITNSRPPCVIL Sbjct 144540 PLSPQLIEAIRRARNGEPLEKITNSRPPCVIL 144635 >PTFA01000038.1 Casuarius casuarius isolate B32419 scaffold_37, whole genome shotgun sequence Length=6381071 Score = 30.8 bits (68), Expect = 6.0, Method: Composition-based stats. Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 0/32 (0%) Frame = +2 Query 27 VEYCEPCGFEATYLELASAVKEQYPGIEIESR 58 V YC PC F A +L + S V Y ++E+R Sbjct 4917743 VNYCAPCSFPAFWLPILSQVLGCYHSCDLETR 4917838 Lambda K H a alpha 0.314 0.136 0.391 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 10067847225 Database: genome.fa Posted date: Oct 19, 2018 9:06 AM Number of letters in database: 1,209,001,349 Number of sequences in database: 3,184 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40