TBLASTN 2.6.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 3,184 sequences; 1,209,001,349 total letters Query= SPP00000017_1.0 # Protein # Selenoprotein M (SelM) # Homo sapiens # Complete Length=145 Score E Sequences producing significant alignments: (Bits) Value PTFA01000067.1 Casuarius casuarius isolate B32419 scaffold_66, w... 68.6 1e-12 >PTFA01000067.1 Casuarius casuarius isolate B32419 scaffold_66, whole genome shotgun sequence Length=4600841 Score = 68.6 bits (166), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%) Frame = +3 Query 93 ERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKP 135 +RIPLS+MTREEIN LVQELGFYRK APDA VP + +APAKP Sbjct 31851 QRIPLSDMTREEINRLVQELGFYRKEAPDAPVPERFQFAPAKP 31979 Score = 48.9 bits (115), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 32/77 (42%), Positives = 34/77 (44%), Gaps = 36/77 (47%) Frame = +3 Query 53 LKEVKAFVTQDIPF------------------------------------YHNLVMKHLP 76 L +VKAFVT+DIP HNL MKHLP Sbjct 31425 LPQVKAFVTEDIPL*YPPSRRGGRRGRAPRAGVGRLRRVPLLCRLLNPPPSHNLEMKHLP 31604 Query 77 GADPELVLLGRRYEELE 93 GADPELVLL RY ELE Sbjct 31605 GADPELVLLSYRYTELE 31655 Lambda K H a alpha 0.318 0.136 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 13287246753 Database: genome.fa Posted date: Oct 19, 2018 9:06 AM Number of letters in database: 1,209,001,349 Number of sequences in database: 3,184 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40