TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: genome.fa 20,089 sequences; 1,310,797,575 total letters Query= SPP00001043_2.0 # Protein # 15 kDa selenoprotein (Sel15) # Chicken Length=137 Score E Sequences producing significant alignments: (Bits) Value NOIK01000131.1 Anas zonorhyncha breed spot-billed scaffold133, w... 88.6 9e-19 NOIK01000027.1 Anas zonorhyncha breed spot-billed scaffold28, wh... 32.7 2.3 >NOIK01000131.1 Anas zonorhyncha breed spot-billed scaffold133, whole genome shotgun sequence Length=2205192 Score = 88.6 bits (218), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%) Frame = -1 Query 93 IKYVRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKLERL 137 ++YVRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKLERL Sbjct 872871 LQYVRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKLERL 872737 Score = 84.3 bits (207), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%) Frame = -1 Query 1 INVYGAQLSSEACRELGFssnllcsscnllGQFSLNQLDPFCRQCCQEEAQLETRKL 57 + VYGAQLSSEACRELGFSSNLLCSSCNLLGQF+LNQLDPFCRQCCQEEAQLETRK+ Sbjct 891360 VYVYGAQLSSEACRELGFSSNLLCSSCNLLGQFNLNQLDPFCRQCCQEEAQLETRKV 891190 Score = 44.3 bits (103), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/57 (46%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -3 Query 38 LDPFCRQCCQEEAQLETRKLYAGAVLEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIK 94 L P ++ L L+AG + + FPQ AFVRSDKPKLFRGLQIK Sbjct 874780 LKPHSKRNN*GNTSLNINLLHAGGKVLIL---FISFPQTLAFVRSDKPKLFRGLQIK 874619 Score = 42.7 bits (99), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%) Frame = -3 Query 56 KLYAGAVLEVCGUKLGRFPQVQA 78 +LYAGAVLEVCG KLGRFPQVQ Sbjct 882073 QLYAGAVLEVCG*KLGRFPQVQG 882005 >NOIK01000027.1 Anas zonorhyncha breed spot-billed scaffold28, whole genome shotgun sequence Length=5301505 Score = 32.7 bits (73), Expect = 2.3, Method: Compositional matrix adjust. Identities = 21/64 (33%), Positives = 34/64 (53%), Gaps = 3/64 (5%) Frame = +1 Query 65 VCGUKLGRFPQVQAFVRS-DKPKLFRGLQIKYVRGSDPVLKLLDDSGNIAEELSILKWNT 123 +CG +L + Q F + D+ ++ GLQ+ Y RGS L+ + I + L+ LKW T Sbjct 2432731 LCGFQL--LKETQWFSSTVDEQSIYCGLQLLYQRGSCGGLEFITSPTGILDGLNNLKWPT 2432904 Query 124 DSVE 127 S + Sbjct 2432905 GSCQ 2432916 Lambda K H a alpha 0.320 0.138 0.406 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 11302268796 Database: genome.fa Posted date: Oct 23, 2017 5:50 PM Number of letters in database: 1,310,797,575 Number of sequences in database: 20,089 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40