TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a 25 sequences; 708,396,389 total letters Query= SPP00000632_2.0 # Protein # 15 kDa selenoprotein (Sel15) # Zebrafish Length=146 Score E Sequences producing significant alignments: (Bits) Value KQ557225.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 85.5 7e-18 KQ557221.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 72.0 2e-13 > KQ557225.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold24, whole genome shotgun sequence Length=55650406 Score = 85.5 bits (210), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Frame = +3 Query 103 KYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI 146 +YVRGSDP+LKLLDDNGNIAEELSI KWNTDSVEEFLSEKL+RI Sbjct 3581196 QYVRGSDPILKLLDDNGNIAEELSITKWNTDSVEEFLSEKLDRI 3581327 Score = 45.8 bits (107), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 32/88 (36%), Positives = 36/88 (41%), Gaps = 49/88 (56%) Frame = +1 Query 65 KLYPGAILEVCGXKLGRFPQVQ-------------------------------------- 86 +LY GAILEVCG KLGRFPQVQ Sbjct 3580321 QLYAGAILEVCG*KLGRFPQVQGKFWEEKLVQTSICYLVTSAVSPQLFLPHSQDVRPSVR 3580500 Query 87 -----------AFVRSDKPKLFRGLQIK 103 AFVRS+ PK+F+GLQIK Sbjct 3580501 PHDLCLCFFPSAFVRSEMPKMFKGLQIK 3580584 > KQ557221.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold20, whole genome shotgun sequence Length=29933922 Score = 72.0 bits (175), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%) Frame = +3 Query 2 FLLVFFAQLASYGAELSSEACRELGFssnllcsscellGQFSLNQLDLPCRQCCQEEAQL 61 L F QL++YGA+LSSEACRELGFSSNLLCSSC+LLG+FSL +L CRQCCQ+EAQ+ Sbjct 2809353 HLTCVFLQLSAYGADLSSEACRELGFSSNLLCSSCDLLGEFSLTKLQPVCRQCCQQEAQM 2809532 Query 62 ENRKLYPG 69 E+RK+ G Sbjct 2809533 ESRKVKQG 2809556 Lambda K H a alpha 0.322 0.140 0.414 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 8736787948 Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a Posted date: Oct 21, 2016 4:48 PM Number of letters in database: 708,396,389 Number of sequences in database: 25 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40