TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a 25 sequences; 708,396,389 total letters Query= SPP00000633_2.0 # Protein # Selenoprotein K (SELENOK) # Zebrafish Length=94 Score E Sequences producing significant alignments: (Bits) Value KQ557201.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 58.2 3e-09 KQ557211.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 29.3 6.6 > KQ557201.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold0, whole genome shotgun sequence Length=29966060 Score = 58.2 bits (139), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%) Frame = +2 Query 6 NGQVLDSRSRSPWSLSFLTDFFWGAVEFIGL 36 +GQVLDSRS+SPWSLSFLTD FWGAVEFI L Sbjct 8675462 SGQVLDSRSQSPWSLSFLTDMFWGAVEFISL 8675554 Score = 31.2 bits (69), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 1/23 (4%) Frame = +2 Query 38 FQTLVQPDLSKDGNNSASSRFSD 60 F+T++ PDLSK G N ASSRFSD Sbjct 8676248 FRTILHPDLSKKG-NVASSRFSD 8676313 > KQ557211.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold10, whole genome shotgun sequence Length=26077971 Score = 29.3 bits (64), Expect = 6.6, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query 11 DSRSRSPWSLSFLTDFFWGAVEFIGLFFQTLVQP--DLSKDGNNSAS 55 DSRS +P SL L F + A+ + + VQP DL +D + +S Sbjct 13297273 DSRSSAPQSLGILVHFLFAALLQLHQVMEMSVQPCSDLVRDIQSDSS 13297413 Lambda K H a alpha 0.322 0.135 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5903260100 Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a Posted date: Oct 21, 2016 4:48 PM Number of letters in database: 708,396,389 Number of sequences in database: 25 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40