TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a 25 sequences; 708,396,389 total letters Query= SPP00000634_2.0 # Protein # Selenoprotein H (SELENOH) # Zebrafish Length=127 Score E Sequences producing significant alignments: (Bits) Value KQ557216.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 60.1 1e-09 KQ557212.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 32.3 1.5 > KQ557216.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold15, whole genome shotgun sequence Length=30170098 Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%) Frame = +2 Query 49 RVYGRNAVVVREALADSHPELKVMINPHNPRRNSFEITLMDGERADV 95 RVYGRNA V+ AL + P L V++NP PRRNSFEITL+DG + ++ Sbjct 15575111 RVYGRNAEEVKSALLAARPGLTVVLNPEKPRRNSFEITLLDGGKGEM 15575251 Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%) Frame = +3 Query 96 LWSGIKKGPPRKLKFPEPAEVVTALKQALEKE 127 LW+GIKKGPPRKLKFP+P VV AL++AL+ E Sbjct 15575592 LWTGIKKGPPRKLKFPQPDSVVAALQEALKTE 15575687 > KQ557212.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold11, whole genome shotgun sequence Length=29398440 Score = 32.3 bits (72), Expect = 1.5, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%) Frame = +2 Query 70 KVMINPHNPRRNSFEITL 87 K M+NPHNP RN F +T+ Sbjct 22078094 KTMVNPHNPSRNCFFLTI 22078147 Lambda K H a alpha 0.317 0.133 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5903239475 Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a Posted date: Oct 21, 2016 4:48 PM Number of letters in database: 708,396,389 Number of sequences in database: 25 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40