TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a 25 sequences; 708,396,389 total letters Query= SPP00000615_2.0 # Protein # Fish selenoprotein 15 (SELENOE) # Zebrafish Length=138 Score E Sequences producing significant alignments: (Bits) Value KQ557204.1 Xiphophorus couchianus unplaced genomic scaffold Sca... 75.1 2e-14 > KQ557204.1 Xiphophorus couchianus unplaced genomic scaffold Scaffold3, whole genome shotgun sequence Length=33259606 Score = 75.1 bits (183), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/41 (85%), Positives = 40/41 (98%), Gaps = 0/41 (0%) Frame = +2 Query 98 MKADEISSLLDSLGFYKRSEKGEEVPEEFKHFPLRAPRDEL 138 MKADEISSLL+SLGFYKRS+KGE+VPEEF++FPL APRDEL Sbjct 27573926 MKADEISSLLESLGFYKRSQKGEKVPEEFQNFPLHAPRDEL 27574048 Score = 44.3 bits (103), Expect = 2e-04, Method: Composition-based stats. Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%) Frame = +1 Query 38 LVAPSVVGXSIKKMPELYNFLMERWAL 64 L APSVVG +IKKMPEL++FLMER AL Sbjct 27573172 LQAPSVVG*AIKKMPELHHFLMERSAL 27573252 Score = 39.7 bits (91), Expect = 0.005, Method: Compositional matrix adjust. Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%) Frame = +2 Query 66 HNLEYDSGEDKNPRLIFYN 84 HNLEYDS E+K PRLIFYN Sbjct 27573449 HNLEYDSSEEKKPRLIFYN 27573505 Score = 36.6 bits (83), Expect = 0.066, Method: Compositional matrix adjust. Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 0/35 (0%) Frame = +1 Query 98 MKADEISSLLDSLGFYKRSEKGEEVPEEFKHFPLR 132 M EI+ LL+ LGFYK+++ +EVPEE + P + Sbjct 17387677 MTRSEINELLEKLGFYKKAQPEDEVPEELRFAPAK 17387781 Lambda K H a alpha 0.315 0.134 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 7083882870 Database: /export/cursos/20428/BI/genomes/2016/Xiphophorus_couchianus/genome.f a Posted date: Oct 21, 2016 4:48 PM Number of letters in database: 708,396,389 Number of sequences in database: 25 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40