TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Manis_javanica/genome.fa 80,669 sequences; 2,547,379,330 total letters Query= SPP00000076_2.0 # Protein # Selenoprotein K (SELENOK) # Human Length=94 Score E Sequences producing significant alignments: (Bits) Value JSZB01010020.1 Manis javanica isolate MP_PG03-UM SCAFFOLD11746,... 62.0 5e-10 JSZB01015768.1 Manis javanica isolate MP_PG03-UM SCAFFOLD19060,... 32.0 2.9 > JSZB01010020.1 Manis javanica isolate MP_PG03-UM SCAFFOLD11746, whole genome shotgun sequence Length=282983 Score = 62.0 bits (149), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%) Frame = -2 Query 7 GQVLDSRSQSPWRLSLITDFFWGIAEFVVL 36 GQVLDSRSQSPWRLSLITDFFWGIAEFV L Sbjct 263644 GQVLDSRSQSPWRLSLITDFFWGIAEFVFL 263555 Score = 49.3 bits (116), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 1/31 (3%) Frame = -2 Query 33 FVVLF-FKTLLQQDVKKRRSYGNSSDSRYDD 62 F F FKTLLQQDVKKRR YG+SSDSRYDD Sbjct 262120 FSACFSFKTLLQQDVKKRRGYGSSSDSRYDD 262028 > JSZB01015768.1 Manis javanica isolate MP_PG03-UM SCAFFOLD19060, whole genome shotgun sequence Length=266901 Score = 32.0 bits (71), Expect = 2.9, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +2 Query 2 VYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDV----KKRRSYGN 54 +Y+ +L+ S W LSLI+D FW + F L LL V KK+R G+ Sbjct 183851 MYLHISIILNLSSMCMWELSLISDVFWWLLFFP*LILPRLLFYSVINKKKKKRGLGS 184021 Lambda K H a alpha 0.325 0.138 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 21089007050 Database: /export/cursos/20428/BI/genomes/2016/Manis_javanica/genome.fa Posted date: Oct 21, 2016 4:42 PM Number of letters in database: 2,547,379,330 Number of sequences in database: 80,669 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40