TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Miichthys_miiuy/genome.fa 6,294 sequences; 619,300,777 total letters Query= SPP00000634_2.0 # Protein # Selenoprotein H (SELENOH) # Zebrafish Length=127 Score E Sequences producing significant alignments: (Bits) Value JXSJ01000003.1 Miichthys miiuy scaffold3, whole genome shotgun ... 70.1 6e-13 > JXSJ01000003.1 Miichthys miiuy scaffold3, whole genome shotgun sequence Length=10388247 Score = 70.1 bits (170), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%) Frame = -1 Query 41 VIEHCKSXRVYGRNAVVVREALADSHPELKVMINPHNPRRNSFEITLMDGERADV 95 VI KS RVYGRNA V+ AL +HP L V++NP PRRNSFEITL+DG + ++ Sbjct 9699972 VISGSKS*RVYGRNAEAVKSALLAAHPGLTVVLNPEKPRRNSFEITLLDGGKGEI 9699808 Score = 52.0 bits (123), Expect = 5e-07, Method: Composition-based stats. Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%) Frame = -1 Query 96 LWSGIKKGPPRKLKFPEPAEVVTALKQALEKE 127 LW+GIKKGPPRKLKFP+P VV AL++ L+ E Sbjct 9699030 LWTGIKKGPPRKLKFPQPDVVVAALQEVLKNE 9698935 Lambda K H a alpha 0.317 0.133 0.385 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5144790100 Database: /export/cursos/20428/BI/genomes/2016/Miichthys_miiuy/genome.fa Posted date: Oct 21, 2016 4:44 PM Number of letters in database: 619,300,777 Number of sequences in database: 6,294 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40