TBLASTN 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: /export/cursos/20428/BI/genomes/2016/Miichthys_miiuy/genome.fa 6,294 sequences; 619,300,777 total letters Query= SPP00000615_2.0 # Protein # Fish selenoprotein 15 (SELENOE) # Zebrafish Length=138 Score E Sequences producing significant alignments: (Bits) Value JXSJ01000024.1 Miichthys miiuy scaffold24, whole genome shotgun... 84.7 9e-18 JXSJ01000037.1 Miichthys miiuy scaffold37, whole genome shotgun... 38.5 0.013 > JXSJ01000024.1 Miichthys miiuy scaffold24, whole genome shotgun sequence Length=3976164 Score = 84.7 bits (208), Expect = 9e-18, Method: Composition-based stats. Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%) Frame = +3 Query 98 MKADEISSLLDSLGFYKRSEKGEEVPEEFKHFPLRAPRDEL 138 MKADEISSLLDSLGFYKRS+KGEEVPEEF+HFPLR PRDEL Sbjct 1416627 MKADEISSLLDSLGFYKRSQKGEEVPEEFQHFPLRTPRDEL 1416749 Score = 49.3 bits (116), Expect = 4e-06, Method: Composition-based stats. Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%) Frame = +1 Query 38 LVAPSVVGUSIKKMPELYNFLMERWAL 64 L APSVVG IKKMPEL++FLMERWAL Sbjct 1415230 LQAPSVVG*GIKKMPELHHFLMERWAL 1415310 Score = 45.4 bits (106), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 7/43 (16%) Frame = +3 Query 49 KKMPELYNF-------LMERWALYHNLEYDSGEDKNPRLIFYN 84 K+M LY+F L+ + HNLEYDS E+KNPRLIFYN Sbjct 1415520 KQMDVLYSFTVYLLFPLIRSFLCSHNLEYDSSEEKNPRLIFYN 1415648 > JXSJ01000037.1 Miichthys miiuy scaffold37, whole genome shotgun sequence Length=2858176 Score = 38.5 bits (88), Expect = 0.013, Method: Compositional matrix adjust. Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Frame = -2 Query 98 MKADEISSLLDSLGFYKRSEKGEEVPEEFKHFPLR 132 M EI+ LL+ LGFYK+++ +EVPEEF+ P + Sbjct 1022442 MTRSEINELLEKLGFYKKAQAEDEVPEEFRFSPAK 1022338 Lambda K H a alpha 0.315 0.134 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 6378564154 Database: /export/cursos/20428/BI/genomes/2016/Miichthys_miiuy/genome.fa Posted date: Oct 21, 2016 4:44 PM Number of letters in database: 619,300,777 Number of sequences in database: 6,294 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 13 Window for multiple hits: 40