Need help with output?
Total number of SECIS elements predicted: 1
Number of known selenoproteins predicted: 1
You can download here these output files: or scroll down to inspect each result.
Selenoprotein id: 1         Category: known selenoprotein
help
Protein prediction
Predicted by: exonerate Blastx evalue: 1e-29
Query protein: gi|884952294|ref|XP_010863851.2| PREDICTED: redox-regulatory protein FAM213A-like [Esox lucius]
Positions on query: 53-210 Query length: 218

Target name: JARO01005685.1:subseq_874,52368_
Positions on target: 47500-47580,48214-48354,48488-48652,50003-50089 Strand: +
Has a Redox Box!


  Query   FKAKQLWEMSGAVVMAVRRPGUFLCRE <---Intron---> EAAELSSLKPQLDELGVPLYAVVKEDM
           ||/ ||/ /|||||||||||| |||| <   633bp    > ||/|||||||||/| ||||||||||//
  Target  LKAQALWKKTGAVVMAVRRPGUSLCRE                EASELSSLKPQLEEHGVPLYAVVKENI
          cagcgctaaaggggaggcccgttttag                ggtgcttcacccggcggcctgggagaa
          tacactgaacgctttctggcggctgga                accatcctacataaagtctacttaaat
          cacgctggggtggcgcgcgtaacgcag                gctggctcgcgggacgctgccagggcc
                               *                                                
  
  Query   GTEIQNFRPYFSGEIFVDEK <---Intron---> RHFYGPRERKMGLLAFLRVGVWMNGLRAFKRGFL
          |||/|/|||||/|/||/||| <   133bp    > / ||||/ |/|  |  /|/||  |  || //|| 
  Target  GTEVQDFRPYFAGDIFLDEK                QRFYGPQPRRMIGLGLIRMGVLQNFARAKRKGFQ
          gaggcgtacttgggatcgga                ccttgcccaaaagcgcacaggccatgcgaaagtc
          gcataatgcatcgatttaaa                agtagcacggttgtgttgtgttaatcgcagagta
          cagcgccaccctgcccgtgg                acccccgtgggcagacctgggggctcacggaccg
                                                                                
  
  Query   GNVFGEGFVLGGVFVIGAGQQ <---Intron---> GILLEHREMEFGDKVNILEVLKAARKVER
          ||/ |||| || ||||| |/| <   1350bp   > |||||||| |||||||/  ||/| /||//
  Target  GNIKGEGFTLGAVFVIGPGKQ                GILLEHREKEFGDKVNMSSVLEAVQKVQK
          gaaagggtacgggtgagcgac                gaccgccgagtggagaattgtgggcagca
          gatagagtctgcttttgcgaa                gtttaagaaatgaatatccttactaataa
          cccgggccagtggtgcatgag                gctgacggggtgcgccgaccagacggcgg
                                                                            
  
SECIS prediction
help
SECIS image
Predicted by: Infernal (score 32.85)
Covels score: 28.59
Free Energy of structure: -16.0
Target name: JARO01005685.1:subseq_874,52368_
Positions on target: 51485-51558 Strand: +
Distance between candidate CDS and SECIS: 1395
Distance between Sec-UGA and SECIS: 1803
SECIS grade: A

  SEQ  UGCGGGCACUUUUAUGACGGCCUGCAUUUUAACCCCCGCUGGGACAGAGCAGGCUCGAUGCGUGUGUGUUCGCA
  SS   (((((((((.....{[[{((((((.[(((................)))]))))))}]]}......)))))))))