Total number of SECIS elements predicted: 1
Number of known selenoproteins predicted: 1
You can download here these output files: or scroll down to inspect each result.
Selenoprotein id: 1         Category: known selenoprotein
help
Protein prediction
Predicted by: exonerate Blastx evalue: 3e-52
Query protein: gi|831573008|ref|XP_012735547.1| PREDICTED: glutathione peroxidase 2 [Fundulus heteroclitus]
Positions on query: 1-190 Query length: 191

Target name: JARO01004340.1:subseq_1,32778_
Positions on target: 9605-9826,8731-9078 Strand: -


  Query   MTFIAKTFYDLRATSLEGDPVDFNVFRGRVVLIENVASLUGTTTRDFSELSQLQGKYPHRLVVLGFPCNQ
          | ||||||||||||||/|/ /|||//||||||||||||||||||||/|/|//|||/||||||||||||||
  Target  MAFIAKTFYDLRATSLQGESIDFNIYRGRVVLIENVASLUGTTTRDYSQLNELQGRYPHRLVVLGFPCNQ
          agtagaattgccgatccggtagtaatagcggtagaggtctgaaacgtaccagccgatccccggcgtctac
          tcttcactaatgccctagactatatagggttttaatcctggcccgaagataataggacagttttgtcgaa
          ggcctgtcccctgatggggcctccccaaggcgcgtgcttagcccgcccgctgggcactcgagcgccaccg
                                                 *                              
  
  Query   FGYQ <---Intron---> ENCTNGEILHSLQHVRPGGGFKPNFTMFEKCDVNGANTHPVFAYLKSKLP
          |||| <   526bp    > |||||||||/|| |||||||||| ||||||||||| |||||||||| |||
  Target  FGYQ                ENCTNGEILNSLMHVRPGGGFKPCFTMFEKCDVNGTNTHPVFAYLKDKLP
          tgtc                gataaggacatcacgccgggtacttaatgatggagaaaccgtgtcagacc
          tgaa                aagcagattacttatgcgggtacgtcttaagatagcacacttcataaatc
          cgcg                gccatagagcaggcgcaaagcggcccgtggtcgccacacgtcatgatatc
                                                                                
  
  Query   FPEDDPSSLMQDPKFLVWSPVSRADVSWNFEKFLIGPEGEPFKRYSKNFPTIDVEPDIQRLLRLTK
          /|/|||| |/|||||||||||||||/||||||||||||||||||||||| |||/||||||||/|||
  Target  YPDDDPSILIQDPKFLVWSPVSRADISWNFEKFLIGPEGEPFKRYSKNFKTIDIEPDIQRLLKLTK
          tcgggcaacacgcatcgtacgaaggattatgattagcgggctactaaataaagagcgaccctacaa
          acaaacgtttaacatttggctggcatcgataatttgcagactagagaatactatacatagttatca
          ttttccccccaccgctggcaccggcccgctagtgcgcgaggtgcccattaccctgcccgacaaacg
                                                                            
  

SECIS prediction
help
SECIS image
Predicted by: Infernal (score 15.73)
Covels score: 19.9
Free Energy of structure: -5.6
Target name: JARO01004340.1:subseq_1,32778_
Positions on target: 8551-8620 Strand: -
Distance between candidate CDS and SECIS: 110
Distance between Sec-UGA and SECIS: 560
SECIS grade: A

  SEQ  UGAGAUUUAUUACAUGAAGAUAGUAUUCUAAAAUGUCAAAGGAAUAAUGUCAGAGGCUUUGUAAAAUCUC
  SS   .({({(((((....([[{(((([((((((...........))))))]))))}]]).....)))))})}).