Need help with output?
Total number of SECIS elements predicted: 1
Number of known selenoproteins predicted: 1
You can download here these output files: or scroll down to inspect each result.
Selenoprotein id: 1         Category: known selenoprotein
help
Protein prediction
Predicted by: exonerate Blastx evalue: 5e-04
Query protein: gi|923841802|ref|XP_013768811.1| PREDICTED: selenoprotein M-like [Pundamilia nyererei] >gi|930743504|ref|XP_014191146.1| PREDICTED: selenoprotein M-like [Haplochromis burtoni]
Positions on query: 4-135 Query length: 135

Target name: JARO01011017.1:subseq_1,11722_
Positions on target: 5483-5581,5693-5769,6195-6273,6645-6785 Strand: +


  Query   FLVLTLTLALRLSEANNDTVGEEKLVIARAKLL <---Intron---> APSVVGUSIKKMPELYHFLME
           ||| |/ /    /   /   |||/ ||| ||| <   111bp    > |||||||||||||/|  ||||
  Target  LLVLALSHSTICDKNTLEMTTEEKVEIARGKLL                APSVVGUSIKKMPQLLEFLME
          tcgtgctcaaatgaaacgaaaggaggagagact                gcagggttaaaaccccgtcag
          ttttctcagctgaaactatccaaatatcggatt                ccgttggctaatcattattta
          gtggcgtttatctatcaggctaaataacaagcg                accttaattgggaactgtggg
                                                                 *              
  
  Query   RMALY <---Intron---> HNLEYDSSEEKKPRLIFYNEKDEIVKT <---Intron---> VSVKKM
          | ||| <   425bp    > ||||||| ||| |||/||| |||/||| <   371bp    > ||||||
  Target  RWALY                HNLEYDSGEEKNPRLLFYNSKDEVVKT                VSVKKM
          ctgct                catgtgtgggaaccccttataggggaa                gtgaaa
          ggcta                aataaacgaaaacgtttaacaaatta                ctctaat
          ggaa                tttagttagaaatcattcctaatatgg                ttagggg
                                                                                
  
  Query   KADEISSLLDSLGFYKRSKKGEEVPEEFQHFPLRAPRDEL
          ||||||/||||||||/|||||||||/|||||||  |||||
  Target  KADEISNLLDSLGFYRRSKKGEEVPKEFQHFPLWTPRDEL
          agggaaatcgttgttaataaggggcagtcctcctacaggc
          acaatgattactgtaggcaagaatcaataatctgccgaat
          aatgctcgactaaccagcggaaggtgacgttcggatgtgt
                                                  
  
SECIS prediction
help
SECIS image
Predicted by: Infernal (score 17.03)
Covels score: 19.8
Free Energy of structure: -16.5
Target name: JARO01011017.1:subseq_1,11722_
Positions on target: 6817-6892 Strand: +
Distance between candidate CDS and SECIS: 31
Distance between Sec-UGA and SECIS: 307
SECIS grade: A

  SEQ  CACCAAGUCAAAAUGACGUCUGGGACCGGAGGGUCGAACUGGGCCUGGUUCCAUGACUGAGAAAGUCGACUUUCUG
  SS   ....(((((....([[{((((((((((((...............))))))))).)))}]])......)))))....