TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000114_2.0 # Protein # Selenoprotein U2 (SelU2) # Human (Homo sapiens) (226 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN342762.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 83 2e-16 >KN342762.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold20684, whole genome shotgun sequence Length = 68143 Score = 83.2 bits (204), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 142 QSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHR 193 QSPH+KSNLLSGS++S+WRA+T P FD QGDPAQQGGTLILGPG FI + Sbjct: 19525 QSPHVKSNLLSGSIRSIWRAMTSPAFDLQGDPAQQGGTLILGPGKLTCFILK 19680 Score = 71.2 bits (173), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +2 Query: 184 PGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV 226 PG+ +HF+H D+NRLDH PIN+VLQL GV+ VNFTN+P VIHV Sbjct: 20504 PGSEVHFLHFDKNRLDHAPINTVLQLAGVKTVNFTNKPQVIHV 20632 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 104 IEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQS 143 ++PFC LT Y HE+YVDP+ +YK LGMKRGE SSG++ Sbjct: 18242 LQPFCNLTRYPHEMYVDPDLALYKILGMKRGEAATSSGRN 18361 Score = 43.5 bits (101), Expect = 0.005, Method: Compositional matrix adjust. Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 67 LCYICKEYVEDLAKIPRSFLQ 87 LCY CKEYVEDLAKIP+ FLQ Sbjct: 16469 LCYACKEYVEDLAKIPKDFLQ 16531 Score = 33.9 bits (76), Expect = 5.0, Method: Compositional matrix adjust. Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 88 EANVTLIVIGQSSYHHIE 105 +ANV LIVIGQSSYHHI+ Sbjct: 17794 DANVRLIVIGQSSYHHIK 17847 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.320 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 579,056,852 Number of extensions: 8715599 Number of successful extensions: 40434 Number of sequences better than 10.0: 3 Number of HSP's gapped: 40432 Number of HSP's successfully gapped: 7 Length of query: 226 Length of database: 729,451,243 Length adjustment: 125 Effective length of query: 101 Effective length of database: 723,532,368 Effective search space: 73076769168 Effective search space used: 73076769168 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)