TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00001058_2.0 # Protein # Selenoprotein S (SelS) # Chicken (Gallus gallus) (194 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN343631.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 57 1e-07 KN326473.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 5.9 >KN343631.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold21586, whole genome shotgun sequence Length = 229554 Score = 56.6 bits (135), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Frame = -2 Query: 29 TVGALLSSYGWYILLACVAIYLIVQKI--SPYLRMRPSSQQGATGAAVEPDM 78 +VGALLS+YGWY+LLAC+AIYL+VQK+ S R RP A G P + Sbjct: 180350 SVGALLSAYGWYLLLACIAIYLLVQKVAESTRARSRPDPPGAAAGVCPPPRL 180195 Score = 50.4 bits (119), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -1 Query: 73 AVEPDMVVRRQEALLASRLRMQEELNAQA 101 +EPD+VVRRQEAL A+RL+MQEELNAQA Sbjct: 177906 CLEPDVVVRRQEALAAARLKMQEELNAQA 177820 Score = 43.5 bits (101), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 120 IEMWESMQEGKSYKGNLKLSQ 140 I MWESMQEGKSYKGNLKL+Q Sbjct: 176424 IAMWESMQEGKSYKGNLKLNQ 176362 Score = 37.4 bits (85), Expect = 0.31, Method: Compositional matrix adjust. Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 167 GYNPLSGEGGGTCSW 181 GYNPLSGEGGGTCSW Sbjct: 174177 GYNPLSGEGGGTCSW 174133 >KN326473.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold3372, whole genome shotgun sequence Length = 235099 Score = 33.5 bits (75), Expect = 5.9, Method: Compositional matrix adjust. Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 26 LQHTVGALLSSYGWYILLACVAI--YLIVQKISPYLRMRPSSQQ 67 L+H G L SS+GWY+LL V I YLI I P +M S Q+ Sbjct: 200739 LKHGSGQLGSSFGWYMLLRPVQIGNYLIQIWIQPIWKMADSIQR 200870 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.312 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 370,542,759 Number of extensions: 4382398 Number of successful extensions: 23970 Number of sequences better than 10.0: 6 Number of HSP's gapped: 23964 Number of HSP's successfully gapped: 10 Length of query: 194 Length of database: 729,451,243 Length adjustment: 122 Effective length of query: 72 Effective length of database: 723,674,421 Effective search space: 52104558312 Effective search space used: 52104558312 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)