TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000087_2.0 # Protein # Methionine-R-sufoxide reductase 1 (SelR1) # Human (Homo sapiens) (116 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 136 1e-36 KN326078.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 35 0.40 KN324691.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 34 0.61 KN346591.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.5 KN323592.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.6 KN335839.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 2.7 KN330348.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 32 4.5 KN346554.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 32 5.5 KN325864.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 7.2 KN323507.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 8.1 KN343821.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 8.4 KN335858.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 8.9 >KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold5136, whole genome shotgun sequence Length = 54931 Score = 136 bits (343), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 73/124 (58%), Positives = 82/124 (66%), Gaps = 33/124 (26%) Frame = -1 Query: 18 PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAK-------------------- 57 PGVYVC+KCGYELFSS++KY HSSPWPAFT+T+HADSV+K Sbjct: 53392 PGVYVCSKCGYELFSSQAKYEHSSPWPAFTQTVHADSVSKYEERPGALKVGMKPRRAFPL 53213 Query: 58 -------------RPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFV 104 RP +R +VSCGKCGNGLGHEFLNDGPK GQSRF IFSSSLKFV Sbjct: 53212 RPRPWLGRVAGQARPCAHRCPLFQVSCGKCGNGLGHEFLNDGPKKGQSRF*IFSSSLKFV 53033 Query: 105 PKGK 108 PKG+ Sbjct: 53032 PKGE 53021 Score = 80.9 bits (198), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 18 PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKV 69 PGVYVC+KCGYELFSS++KY HSSPWPAFT+T+HADSV+K E R ALKV Sbjct: 53706 PGVYVCSKCGYELFSSQAKYEHSSPWPAFTQTVHADSVSKYEE--RPGALKV 53557 >KN326078.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold2959, whole genome shotgun sequence Length = 311133 Score = 35.0 bits (79), Expect = 0.40, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -1 Query: 73 KCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETS 111 +CG LGH F +DGP+P R+ I S+SL F P K + Sbjct: 134970 QCGAHLGHIF-DDGPRPTGKRYCINSASLSFEPVDKNNA 134857 >KN324691.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold1529, whole genome shotgun sequence Length = 192249 Score = 34.3 bits (77), Expect = 0.61, Method: Compositional matrix adjust. Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 1 MSFCSFFGGEVFQNHFEPGV 20 MSFC+FFG E ++ HFEPG Sbjct: 18947 MSFCAFFGRERYRGHFEPGA 18888 >KN346591.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold24904, whole genome shotgun sequence Length = 160760 Score = 33.5 bits (75), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 1 MSFCSFFGGEVFQNHFEPG 19 MSFC FFGGE ++ H EPG Sbjct: 80025 MSFCVFFGGERYRGHSEPG 80081 >KN323592.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold369, whole genome shotgun sequence Length = 151304 Score = 33.1 bits (74), Expect = 1.6, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = -1 Query: 20 VYVCAKCGYELFS----SRSKYAHSSPWPAFTE 48 V++C +C Y+ FS SRS+Y + PW FT+ Sbjct: 27788 VFLCVRCPYDSFSQVCNSRSRYGYLEPWLGFTQ 27690 >KN335839.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold13212, whole genome shotgun sequence Length = 69771 Score = 32.7 bits (73), Expect = 2.7, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 1 MSFCSFFGGEVFQNHFEPGVY 21 MSFC+FF E ++ HFEPG + Sbjct: 56887 MSFCAFFSRECYRGHFEPGKW 56825 >KN330348.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold7435, whole genome shotgun sequence Length = 69125 Score = 32.0 bits (71), Expect = 4.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 12 FQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHA 52 F+ H PG + A+ E SS+ SSP+P FT IH+ Sbjct: 33105 FETHIAPGTWSSAQSSPE*VSSQVVVPFSSPFPGFTLPIHS 32983 >KN346554.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold24896, whole genome shotgun sequence Length = 94476 Score = 31.6 bits (70), Expect = 5.5, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 12/60 (20%) Frame = +2 Query: 21 YVCAKCGYELFSSRSKYAHS------------SPWPAFTETIHADSVAKRPEHNRSEALK 68 Y C +CG+ + Y + W A TE IH++S RP H ++ ++ Sbjct: 5720 YACGRCGHTILFLNMGYLRTLLQGE**ICHIDMTWVAITEVIHSNSCGLRPYHANTDLVQ 5899 >KN325864.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold2769, whole genome shotgun sequence Length = 75222 Score = 31.2 bits (69), Expect = 7.2, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 26 CGYELFSSRSKYAHSSPWPAFTETIHA-DSVAKRPEHNRSEALKVSCGKC 74 C + L SS ++ SP+P+ +IH DSV +P HN +A+ +C C Sbjct: 67092 CTHPLGSSPTR----SPFPSLPSSIHQRDSVLSKPTHNLHQAMHQTCCFC 67229 >KN323507.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold323, whole genome shotgun sequence Length = 17150 Score = 31.2 bits (69), Expect = 8.1, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 1 MSFCSFFGGEVFQNHFEPGVYVCAKC 26 MSFC+FFG + ++ HF+PG + C Sbjct: 15456 MSFCTFFGRDRYRGHFKPGEWGGTAC 15379 >KN343821.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold21849, whole genome shotgun sequence Length = 62456 Score = 31.2 bits (69), Expect = 8.4, Method: Compositional matrix adjust. Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 1 MSFCSFFGGEVFQNHFEPG 19 MS C+FFGGE ++ HF+PG Sbjct: 40802 MSSCTFFGGEHYRGHFKPG 40746 >KN335858.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold13245, whole genome shotgun sequence Length = 59657 Score = 31.2 bits (69), Expect = 8.9, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 73 KCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVP 105 +C LGH F +DGP+P RF I S +L F P Sbjct: 32569 QCDAHLGHVF-DDGPRPSGQRFCINSVALSFKP 32474 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.320 0.134 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 427,437,846 Number of extensions: 7633066 Number of successful extensions: 30138 Number of sequences better than 10.0: 20 Number of HSP's gapped: 30130 Number of HSP's successfully gapped: 22 Length of query: 116 Length of database: 729,451,243 Length adjustment: 91 Effective length of query: 25 Effective length of database: 725,142,302 Effective search space: 18128557550 Effective search space used: 18128557550 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)