TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000091_2.0 # Protein # Methionine-R-sufoxide reductase 2 (SelR2) # Human (Homo sapiens) (182 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN335858.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 78 4e-15 KN326078.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 55 3e-07 KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 45 8e-04 KN335664.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 37 0.26 >KN335858.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold13245, whole genome shotgun sequence Length = 59657 Score = 77.8 bits (190), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -2 Query: 99 SSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLG 154 SSEKKY SGTGWPSFSEA+GT G +ES+T I++R D SLGSA TEV+C Q +LG Sbjct: 33859 SSEKKYDSGTGWPSFSEAYGTCGRNESNTNIMKRPDNSLGSASTEVLCNQV*IYLG 33692 Score = 61.6 bits (148), Expect = 2e-09, Method: Composition-based stats. Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 148 QCEAHLGHVFPDGPGPNGQRFCINSVALKFKP 179 QC+AHLGHVF DGP P+GQRFCINSVAL FKP Sbjct: 32569 QCDAHLGHVFDDGPRPSGQRFCINSVALSFKP 32474 Score = 52.8 bits (125), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 74 PFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWP 111 PFSGIYLNN E GMYHCVCC++PLF E + + G P Sbjct: 46584 PFSGIYLNNTEPGMYHCVCCNAPLFR*ES*HFNAYGCP 46471 Score = 45.8 bits (107), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -1 Query: 41 SLATCELPLAKSEWQKKLTPEQFYVTREKGTE 72 SL + + WQKKLTPEQFYVTREKGTE Sbjct: 47750 SLTRYDETAIATNWQKKLTPEQFYVTREKGTE 47655 >KN326078.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold2959, whole genome shotgun sequence Length = 311133 Score = 55.1 bits (131), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -1 Query: 144 VVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKP 179 VV QC AHLGH+F DGP P G+R+CINS +L F+P Sbjct: 134982 VVLFQCGAHLGHIFDDGPRPTGKRYCINSASLSFEP 134875 Score = 33.9 bits (76), Expect = 3.4, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 23/28 (82%) Frame = -2 Query: 45 CELPLAKSEWQKKLTPEQFYVTREKGTE 72 C++ ++ + +K+LTP Q++VT+EKGTE Sbjct: 214238 CKVVFSQQDLRKRLTPLQYHVTQEKGTE 214155 >KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold5136, whole genome shotgun sequence Length = 54931 Score = 44.7 bits (104), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 46/134 (34%), Positives = 58/134 (43%), Gaps = 26/134 (19%) Frame = -1 Query: 73 PPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSE-AHGTSGSD-ESHTGIL 130 PPF G+Y+ +K C LFSS+ KY + WP+F++ H S S E G L Sbjct: 53401 PPFPGVYVCSK---------CGYELFSSQAKYEHSSPWPAFTQTVHADSVSKYEERPGAL 53249 Query: 131 ------RR---------LDTSLGSART--------EVVCKQCEAHLGHVF-PDGPGPNGQ 166 RR L G AR +V C +C LGH F DGP Sbjct: 53248 KVGMKPRRAFPLRPRPWLGRVAGQARPCAHRCPLFQVSCGKCGNGLGHEFLNDGPKKGQS 53069 Query: 167 RFCINSVALKFKPR 180 RF I S +LKF P+ Sbjct: 53068 RF*IFSSSLKFVPK 53027 Score = 33.5 bits (75), Expect = 4.4, Method: Compositional matrix adjust. Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 7/94 (7%) Frame = -2 Query: 45 CELPLAKSEWQKKLTPEQFYVTREKGT-----EPPFSGIYLNNKEAGMYHCVCCDSPLFS 99 C LP S + P R +G+ PPF G+Y+ +K C LFS Sbjct: 53814 CVLPPTTSSTRSCDRPRSTLGQRCRGSPVNLPAPPFPGVYVCSK---------CGYELFS 53662 Query: 100 SEKKYCSGTGWPSFSE-AHGTSGSD-ESHTGILR 131 S+ KY + WP+F++ H S S E G L+ Sbjct: 53661 SQAKYEHSSPWPAFTQTVHADSVSKYEERPGALK 53560 >KN335664.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold13037, whole genome shotgun sequence Length = 100485 Score = 37.4 bits (85), Expect = 0.26, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 55 QKKLTPEQFYVTREKGTEPPFSGIY-LNNKEAGMYHCVC-CDSPLFSS 100 Q KLT + V R + P F IY ++ MYHCVC C + +FSS Sbjct: 22213 QLKLTCNSYGVNRSRKNNPAFWSIYSFQSQNFTMYHCVCSCQAEVFSS 22070 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.317 0.134 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 547,494,816 Number of extensions: 9938178 Number of successful extensions: 55217 Number of sequences better than 10.0: 14 Number of HSP's gapped: 55204 Number of HSP's successfully gapped: 21 Length of query: 182 Length of database: 729,451,243 Length adjustment: 121 Effective length of query: 61 Effective length of database: 723,721,772 Effective search space: 44147028092 Effective search space used: 44147028092 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)