TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00001056_2.0 # Protein # Methionine-R-sufoxide reductase 1 (SelR1) # Chicken (Gallus gallus) (107 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 149 2e-41 KN324691.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 34 0.62 KN346591.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.7 KN323592.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.9 KN330348.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.9 KN335839.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 32 2.3 KN343821.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 5.8 KN323507.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 31 7.0 >KN328135.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold5136, whole genome shotgun sequence Length = 54931 Score = 149 bits (377), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 78/125 (62%), Positives = 87/125 (69%), Gaps = 35/125 (28%) Frame = -1 Query: 18 PGVYVCARCGYELFSSRAKYEHSSPWPAFTETIHEDSVAKRKERPGALK----------- 66 PGVYVC++CGYELFSS+AKYEHSSPWPAFT+T+H DSV+K +ERPGALK Sbjct: 53392 PGVYVCSKCGYELFSSQAKYEHSSPWPAFTQTVHADSVSKYEERPGALKVGMKPRRAFPL 53213 Query: 67 ------------------------VSCGKCGNGLGHEFLNDGPKRGQSRFUIFSSSLKFI 102 VSCGKCGNGLGHEFLNDGPK+GQSRF IFSSSLKF+ Sbjct: 53212 RPRPWLGRVAGQARPCAHRCPLFQVSCGKCGNGLGHEFLNDGPKKGQSRF*IFSSSLKFV 53033 Query: 103 PKGEG 107 PKGEG Sbjct: 53032 PKGEG 53018 Score = 94.0 bits (232), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = -2 Query: 18 PGVYVCARCGYELFSSRAKYEHSSPWPAFTETIHEDSVAKRKERPGALKV 67 PGVYVC++CGYELFSS+AKYEHSSPWPAFT+T+H DSV+K +ERPGALKV Sbjct: 53706 PGVYVCSKCGYELFSSQAKYEHSSPWPAFTQTVHADSVSKYEERPGALKV 53557 >KN324691.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold1529, whole genome shotgun sequence Length = 192249 Score = 34.3 bits (77), Expect = 0.62, Method: Compositional matrix adjust. Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 1 MSFCSFFGGEVFKDHFEPGV 20 MSFC+FFG E ++ HFEPG Sbjct: 18947 MSFCAFFGRERYRGHFEPGA 18888 >KN346591.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold24904, whole genome shotgun sequence Length = 160760 Score = 32.7 bits (73), Expect = 1.7, Method: Composition-based stats. Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 1 MSFCSFFGGEVFKDHFEPG 19 MSFC FFGGE ++ H EPG Sbjct: 80025 MSFCVFFGGERYRGHSEPG 80081 >KN323592.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold369, whole genome shotgun sequence Length = 151304 Score = 32.7 bits (73), Expect = 1.9, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = -1 Query: 20 VYVCARCGYELFS----SRAKYEHSSPWPAFTE 48 V++C RC Y+ FS SR++Y + PW FT+ Sbjct: 27788 VFLCVRCPYDSFSQVCNSRSRYGYLEPWLGFTQ 27690 >KN330348.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold7435, whole genome shotgun sequence Length = 69125 Score = 32.7 bits (73), Expect = 1.9, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 12 FKDHFEPGVYVCARCGYELFSSRAKYEHSSPWPAFTETIH 51 F+ H PG + A+ E SS+ SSP+P FT IH Sbjct: 33105 FETHIAPGTWSSAQSSPE*VSSQVVVPFSSPFPGFTLPIH 32986 >KN335839.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold13212, whole genome shotgun sequence Length = 69771 Score = 32.3 bits (72), Expect = 2.3, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 1 MSFCSFFGGEVFKDHFEPGVY 21 MSFC+FF E ++ HFEPG + Sbjct: 56887 MSFCAFFSRECYRGHFEPGKW 56825 >KN343821.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold21849, whole genome shotgun sequence Length = 62456 Score = 31.2 bits (69), Expect = 5.8, Method: Compositional matrix adjust. Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 1 MSFCSFFGGEVFKDHFEPG 19 MS C+FFGGE ++ HF+PG Sbjct: 40802 MSSCTFFGGEHYRGHFKPG 40746 >KN323507.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold323, whole genome shotgun sequence Length = 17150 Score = 31.2 bits (69), Expect = 7.0, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -3 Query: 1 MSFCSFFGGEVFKDHFEPGVYVCARCGYELFSSRAKYEHSSP 42 MSFC+FFG + ++ HF+PG + C L A+ H +P Sbjct: 15456 MSFCTFFGRDRYRGHFKPGEWGGTAC-RALLPIGAQGPHGAP 15334 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.323 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 381,639,877 Number of extensions: 6244117 Number of successful extensions: 24890 Number of sequences better than 10.0: 15 Number of HSP's gapped: 24887 Number of HSP's successfully gapped: 17 Length of query: 107 Length of database: 729,451,243 Length adjustment: 82 Effective length of query: 25 Effective length of database: 725,568,461 Effective search space: 18139211525 Effective search space used: 18139211525 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)