TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000070_2.0 # Protein # Selenoprotein H (SelH) # Human (Homo sapiens) (122 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN331620.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 64 3e-11 >KN331620.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold8777, whole genome shotgun sequence Length = 74145 Score = 63.9 bits (154), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -1 Query: 45 RVYGRNAAALSQALRLEAPELPVKVNPTKPRRGSFEVTLLRPDGSS 90 RVYGRNA+A+S+ALR L V++NP KPRR SFEV+L++ DGSS Sbjct: 17622 RVYGRNASAVSEALRHAVDNLTVEINPEKPRRNSFEVSLVKEDGSS 17485 Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 37/62 (59%), Gaps = 11/62 (17%) Frame = -2 Query: 72 TKPRRGSFEV-----------TLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKY 120 TKPR G + +LL ELW+GIKKGPPRKLKFPEP++VVE LK Sbjct: 17249 TKPRHGLLQYNPVTSTLSVTPSLLCLHILVVELWSGIKKGPPRKLKFPEPEKVVEALKSS 17070 Query: 121 LS 122 L+ Sbjct: 17069 LA 17064 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.314 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 268,919,281 Number of extensions: 3712870 Number of successful extensions: 10955 Number of sequences better than 10.0: 3 Number of HSP's gapped: 10954 Number of HSP's successfully gapped: 4 Length of query: 122 Length of database: 729,451,243 Length adjustment: 97 Effective length of query: 25 Effective length of database: 724,858,196 Effective search space: 18121454900 Effective search space used: 18121454900 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)