TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000067_2.0 # Protein # 15 kDa selenoprotein (Sel15) # Human (Homo sapiens) (162 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN331551.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 88 5e-19 >KN331551.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold8695, whole genome shotgun sequence Length = 135074 Score = 88.2 bits (217), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -3 Query: 111 KLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI 162 K+ ++YVRGSDPVLKLLDD GNIAEELSILKWNTDSVEEFLSEKLERI Sbjct: 83298 KVIPFFSLQYVRGSDPVLKLLDDTGNIAEELSILKWNTDSVEEFLSEKLERI 83143 Score = 67.8 bits (164), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 42/68 (61%) Frame = -2 Query: 18 LLATVLQAVSAFGAEFSSEACRELGFXXXXXXXXXXXXGQFNLLQLDPDCRGCCQEEAQF 77 L + +S +G + SSEACRELGF GQF+L QLDP CR CCQEEAQF Sbjct: 130942 LFKYIHFQLSVYGTKLSSEACRELGFSSNLLCSSCSLLGQFSLNQLDPFCRQCCQEEAQF 130763 Query: 78 ETKKLYAG 85 ET+K+ G Sbjct: 130762 ETRKVRFG 130739 Score = 46.6 bits (109), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -2 Query: 76 QFETKKLYAGAILEVCGUKLGRFPQVQA 103 QF T +LYAGA+LEVCG KLGRFPQVQ Sbjct: 105979 QFFTLQLYAGAVLEVCG*KLGRFPQVQG 105896 Score = 43.5 bits (101), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -2 Query: 98 FPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILK 145 FP AFVRSDKPKLFRGLQIK P + N + EE S+ K Sbjct: 85801 FPLTLAFVRSDKPKLFRGLQIKVSNDFSPFIL----NSSC*EEFSVHK 85670 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.323 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 391,503,309 Number of extensions: 4559227 Number of successful extensions: 14966 Number of sequences better than 10.0: 1 Number of HSP's gapped: 14965 Number of HSP's successfully gapped: 4 Length of query: 162 Length of database: 729,451,243 Length adjustment: 119 Effective length of query: 43 Effective length of database: 723,816,474 Effective search space: 31124108382 Effective search space used: 31124108382 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)