TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00002939_2.0 # Protein # seryl-tRNA synthetase 2, mitochondrial (SARS2) # Human (Homo sapiens) (518 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KN325240.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 71 7e-11 KN334931.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 55 8e-06 >KN325240.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold2120, whole genome shotgun sequence Length = 19784 Score = 70.9 bits (172), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 387 RVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEV 419 RVLDMPTQELGLPAYRK DIEAWMPGR ++GEV Sbjct: 6715 RVLDMPTQELGLPAYRKHDIEAWMPGRCKYGEV 6617 Score = 66.6 bits (161), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 270 EGCGMTPNANPSQIYNIDPARFKDLNLAGTAEVGLAG 306 EGCGM P+ANPS IYNIDP+RF+DL LAGT+EVG+AG Sbjct: 7972 EGCGMQPDANPSPIYNIDPSRFEDLCLAGTSEVGIAG 7862 Score = 62.4 bits (150), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = -1 Query: 131 QDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDV 178 Q P Y+ L RGREIR++L LY E QL+E++YL+AL LPNQTHPDV Sbjct: 10085 QIPTYKELLGRGREIRQQLKALYQEEQQLDERYYLKALLLPNQTHPDV 9942 Score = 60.8 bits (146), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 321 RMVCSSTCYRAETNTGQEPRGLYRVHHFTKV 351 RMVCSSTCYR ET+TG+EP GLYRVH FTKV Sbjct: 7401 RMVCSSTCYRTETDTGKEPWGLYRVHQFTKV 7309 Score = 57.4 bits (137), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -1 Query: 218 KRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGC 272 +RLSH+SG+RSYYL GAGALLQH LV F +KL++R + + L GC Sbjct: 8636 RRLSHISGYRSYYLHGAGALLQHALVTFPLDKLVKRVWGGTCLGSLSGAGRAAGC 8472 Score = 57.0 bits (136), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 411 PGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVN 451 P G +++SASNCTD+QSRRLHIM+ AGEL+ AHTV+ Sbjct: 5785 PTPGCPPQISSASNCTDYQSRRLHIMYHDSAGELRHAHTVS 5663 Score = 48.5 bits (114), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 471 KDGSVLVPPALQSYLGTDRITAPTHVPLQYIGPNQPR 507 +DG V VPPALQ +GTD I P PL YIGPNQP+ Sbjct: 5085 QDGRVRVPPALQPMVGTDVIALPRTTPLVYIGPNQPK 4975 Score = 42.0 bits (97), Expect = 0.063, Method: Compositional matrix adjust. Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 450 VNATACAVPRLLIALLESNQ 469 VN TACAVPRLLIALLESNQ Sbjct: 5490 VNGTACAVPRLLIALLESNQ 5431 Score = 35.4 bits (80), Expect = 6.7, Method: Compositional matrix adjust. Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Frame = -3 Query: 127 GEVQQDPKYQGLRARGREIRKELVHL----YPREAQLEEQFYLQALKLPNQTHPDVPVGD 182 G+ Q ++ G RG E + E L P ++++E L+ L+L P P+GD Sbjct: 9717 GKEQAAERWMGPETRGMEQKAEQQRLRCTHAPSQSRMEPS--LRDLQL----SPLKPIGD 9556 Query: 183 ESQARVLHMVGDKP 196 ESQA+VL +VG KP Sbjct: 9555 ESQAKVLEVVGKKP 9514 >KN334931.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold12211, whole genome shotgun sequence Length = 254176 Score = 54.7 bits (130), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -2 Query: 395 ELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMF 437 L A +K D+EAW PG G F E+ S SNCTD+Q+RRL I + Sbjct: 84030 SLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRY 83902 Score = 45.8 bits (107), Expect = 0.004, Method: Compositional matrix adjust. Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = -2 Query: 287 DPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNT-GQEPRGLYRV 345 D + + L T+E +A D + DLP++ STC+R E + G++ RG++RV Sbjct: 85644 DDSSIDEKYLIATSEQPIAALHRDEWLKPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRV 85465 Query: 346 HHFTKV 351 H F KV Sbjct: 85464 HQFEKV 85447 Score = 40.0 bits (92), Expect = 0.29, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = -1 Query: 443 ELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYL 485 +++F H +NAT CA R + A+LE+ Q ++G +++P L+ ++ Sbjct: 82318 QVEFVHMLNATMCATTRTICAILENYQTEEG-IIIPDKLKDFM 82193 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.321 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 1,324,680,193 Number of extensions: 19659315 Number of successful extensions: 79865 Number of sequences better than 10.0: 4 Number of HSP's gapped: 79851 Number of HSP's successfully gapped: 14 Length of query: 518 Length of database: 729,451,243 Length adjustment: 134 Effective length of query: 384 Effective length of database: 723,106,209 Effective search space: 277672784256 Effective search space used: 277672784256 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)