TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00002937_2.0 # Protein # ribosomal protein L30 (RPL30) # Human (Homo sapiens) (115 letters) Database: genome.fa 47,351 sequences; 2,188,353,730 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JRWT01295200.1 Gavialis gangeticus C16438732_1, whole genome sho... 99 1e-23 KN359763.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 98 3e-23 KN328413.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 33 1.4 KN356899.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic... 32 5.5 >JRWT01295200.1 Gavialis gangeticus C16438732_1, whole genome shotgun sequence Length = 2634 Score = 99.0 bits (245), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 55 LRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPG 100 RKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPG Sbjct: 2469 FRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPG 2332 Score = 34.7 bits (78), Expect = 0.48, Method: Composition-based stats. Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 100 GDSDIIRSMPEQTGEK 115 GDSDIIRSMPEQT EK Sbjct: 822 GDSDIIRSMPEQTSEK 775 >KN359763.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold41199, whole genome shotgun sequence Length = 11700 Score = 98.2 bits (243), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +1 Query: 8 KKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56 KKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALR Sbjct: 10471 KKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALR 10617 >KN328413.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold5405, whole genome shotgun sequence Length = 60933 Score = 33.5 bits (75), Expect = 1.4, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = +2 Query: 30 GYKQTLKMIRQGKAKLVILANNCPALRK-----SEIEYYAMLAKTGVHHYSGNNIELGTA 84 GY K R AKL + P L + S+ +Y +L++T +HH ++ L A Sbjct: 31712 GYSHFSK*WRHLGAKLHWKSLGMPLLNEWFSFFSQ*DYIVLLSQTALHHICCGHLHLYKA 31891 Query: 85 CGKYYRVCTLAIIDP 99 K+Y++ +A +DP Sbjct: 31892 SSKHYQIRMVAALDP 31936 >KN356899.1 Gavialis gangeticus isolate Ggan-Ray unplaced genomic scaffold scaffold37262, whole genome shotgun sequence Length = 68345 Score = 31.6 bits (70), Expect = 5.5, Method: Compositional matrix adjust. Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 4/87 (4%) Frame = -1 Query: 22 MKSGKY----VLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGN 77 +SGK+ V+ KQ + + R +A+ + NC +K E E A +K V N Sbjct: 39128 FQSGKHLCR*VILLKQVIDIHRITRAEAI--TENC--YKKIEREL-ASSSKKNV*LPDFN 38964 Query: 78 NIELGTACGKYYRVCTLAIIDPGDSDI 104 NI + A KYY++ +LA+I D+D+ Sbjct: 38963 NIHIY*AIYKYYKISSLAVIQSNDTDL 38883 Database: genome.fa Posted date: Sep 15, 2015 12:21 AM Number of letters in database: 2,188,353,730 Number of sequences in database: 47,351 Lambda K H 0.317 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 47351 Number of Hits to DB: 250,858,338 Number of extensions: 2801566 Number of successful extensions: 10563 Number of sequences better than 10.0: 5 Number of HSP's gapped: 10563 Number of HSP's successfully gapped: 6 Length of query: 115 Length of database: 729,451,243 Length adjustment: 90 Effective length of query: 25 Effective length of database: 725,189,653 Effective search space: 18129741325 Effective search space used: 18129741325 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)