TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000077_2.0 # Protein # Selenoprotein M (SelM) # Human (Homo sapiens) (145 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01035956.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 54 6e-08 BADN01035957.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 49 1e-06 >BADN01035956.1 Thunnus orientalis DNA, contig: superscaffoldBa00000876_0013, whole genome shotgun sequence Length = 9132 Score = 54.3 bits (129), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 93 ERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAK 134 +RI LS+MTR EIN L+ +LGFY+KA P+ +VP E+ ++PAK Sbjct: 8811 QRIALSDMTRSEINELLGKLGFYKKAQPEDEVPEEFRFSPAK 8686 >BADN01035957.1 Thunnus orientalis DNA, contig: superscaffoldBa00000876_0014, whole genome shotgun sequence Length = 4147 Score = 48.5 bits (114), Expect(2) = 1e-06, Method: Compositional matrix adjust. Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -3 Query: 68 HNLVMKHLPGADPELVLLGRRYEELERIPLSEM 100 HNLVMKH+PGADPELVLL +EEL+ P S M Sbjct: 1427 HNLVMKHIPGADPELVLLNHYFEELDVSPPSVM 1329 Score = 23.5 bits (49), Expect(2) = 1e-06, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 55 EVKAFVTQDIPFYHNLVMKH 74 +VKAFV QDIP + L H Sbjct: 1578 QVKAFVVQDIPL*YPLTPVH 1519 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.317 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 82,594,695 Number of extensions: 868418 Number of successful extensions: 3380 Number of sequences better than 1.0e-02: 2 Number of HSP's gapped: 3380 Number of HSP's successfully gapped: 3 Length of query: 145 Length of database: 228,165,821 Length adjustment: 109 Effective length of query: 36 Effective length of database: 213,662,063 Effective search space: 7691834268 Effective search space used: 7691834268 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 40 (20.0 bits)