TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000650_2.0 # Protein # Selenoprotein T (SelT) # Zebrafish (Danio rerio) (210 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01112526.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 103 7e-33 BADN01025730.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 61 1e-09 BADN01025729.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 51 4e-06 BADN01112525.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 42 0.003 >BADN01112526.1 Thunnus orientalis DNA, contig: superscaffoldBa00008212_0002, whole genome shotgun sequence Length = 1914 Score = 103 bits (258), Expect(2) = 7e-33, Method: Compositional matrix adjust. Identities = 53/103 (51%), Positives = 66/103 (64%), Gaps = 23/103 (22%) Frame = +3 Query: 63 ISXGYSKVFQEYSRSISQLYPDIRIEGDNYPPKPIN-----------------------K 99 IS GYSKVFQEYSR+ISQLYPDIRIEG+NYP P+ + Sbjct: 36 IS*GYSKVFQEYSRAISQLYPDIRIEGENYP-HPLQQVSSDISNAPPGVL*HH*PPPPLR 212 Query: 100 YLGNFLSYFKLLAIALIVTGQNPFQMFGMNTPRIWAWGQENKI 142 LGN +SY KL++I LIV+GQN F + G++TPR W W Q+NK+ Sbjct: 213 CLGNLISYLKLVSILLIVSGQNVFVLLGLDTPRAWTWSQDNKV 341 Score = 58.5 bits (140), Expect(2) = 7e-33, Method: Compositional matrix adjust. Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 141 KIFSCLMAFFISNMLETHFLSTGAFEITLN 170 +IFSCLMAFF NM+ETHFLSTGAFE+TLN Sbjct: 406 QIFSCLMAFFFCNMMETHFLSTGAFEVTLN 495 Score = 70.9 bits (172), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = +2 Query: 168 TLNDIPIWSKLQSGYVPNIQELFQILDNHLKMNQADKMNF 207 ++ D+P+WSKLQ+GYVPN+QE+FQILDNHLKMNQ D ++F Sbjct: 1271 SVTDVPVWSKLQAGYVPNVQEIFQILDNHLKMNQVDPVSF 1390 >BADN01025730.1 Thunnus orientalis DNA, contig: superscaffoldBa00000534_0027, whole genome shotgun sequence Length = 5802 Score = 61.2 bits (147), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 99 KYLGNFLSYFKLLAIALIVTGQNPFQMFGMNTPRIWAWGQENKI 142 +++ +FLS FKLL I LI+ G++PF +FGM P IW WGQ NK+ Sbjct: 1141 RHIASFLSVFKLLVIGLIIIGRDPFTLFGMQAPGIWEWGQGNKV 1010 Score = 50.4 bits (119), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 21/37 (56%), Positives = 30/37 (81%) Frame = -2 Query: 63 ISXGYSKVFQEYSRSISQLYPDIRIEGDNYPPKPINK 99 IS GY +VF+EY++++ Q YPDIRIEG+NY P P+ + Sbjct: 4115 IS*GYKRVFEEYTQALYQRYPDIRIEGENYLPIPLYR 4005 >BADN01025729.1 Thunnus orientalis DNA, contig: superscaffoldBa00000534_0026, whole genome shotgun sequence Length = 6634 Score = 50.8 bits (120), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 19/30 (63%), Positives = 28/30 (93%) Frame = -1 Query: 171 DIPIWSKLQSGYVPNIQELFQILDNHLKMN 200 D+P+WSKL+SG++P++Q+L QILDN +KMN Sbjct: 6319 DVPVWSKLESGHLPSMQQLVQILDNEMKMN 6230 Score = 46.6 bits (109), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = -1 Query: 141 KIFSCLMAFFISNMLETHFLSTGAFEITLN 170 +I++C+M FF+SNM+E +STGAFEITLN Sbjct: 6628 QIYACMMVFFLSNMIENQLMSTGAFEITLN 6539 >BADN01112525.1 Thunnus orientalis DNA, contig: superscaffoldBa00008212_0001, whole genome shotgun sequence Length = 2606 Score = 42.4 bits (98), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/61 (37%), Positives = 33/61 (54%) Frame = +3 Query: 1 MAEYSQTGIXXXXXXXXXXXXKDIYVGRNSVTQQENTGPDINTQRQNKHTFYTGPVLKFQ 60 MAEYSQ G+ +D+Y+GR ++ + PD + K + YTGPVL+FQ Sbjct: 1992 MAEYSQAGLLAALLLFTALTVRDLYLGRPGLS--PDNLPDTEPGKPAKPSLYTGPVLRFQ 2165 Query: 61 Y 61 Y Sbjct: 2166 Y 2168 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.321 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 165,945,031 Number of extensions: 2526350 Number of successful extensions: 10305 Number of sequences better than 1.0e-02: 4 Number of HSP's gapped: 10301 Number of HSP's successfully gapped: 8 Length of query: 210 Length of database: 228,165,821 Length adjustment: 116 Effective length of query: 94 Effective length of database: 212,730,629 Effective search space: 19996679126 Effective search space used: 19996679126 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 41 (20.4 bits)