TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000648_2.0 # Protein # Selenoprotein S (SelS) # Zebrafish (Danio rerio) (190 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01048450.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 50 2e-14 >BADN01048450.1 Thunnus orientalis DNA, contig: superscaffoldBa00001412_0016, whole genome shotgun sequence Length = 11117 Score = 50.1 bits (118), Expect(2) = 2e-14, Method: Compositional matrix adjust. Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 110 EEEKRRQKIEMWDSMQEGKSYKGSAKVAQ 138 E+EKRRQKIE+W+SMQ+GKSYKG+ KV+Q Sbjct: 1496 EQEKRRQKIEIWESMQQGKSYKGATKVSQ 1410 Score = 49.7 bits (117), Expect(2) = 2e-14, Method: Compositional matrix adjust. Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 73 DVGSVVRRQEALEASRRRMQEEQDARAAEFREKQ 106 D V RRQEA+EA+RR+MQEE DA+AA FREKQ Sbjct: 1701 DAVLVARRQEAMEAARRKMQEELDAKAALFREKQ 1600 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.312 0.126 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 97,605,283 Number of extensions: 979088 Number of successful extensions: 4933 Number of sequences better than 1.0e-02: 3 Number of HSP's gapped: 4904 Number of HSP's successfully gapped: 4 Length of query: 190 Length of database: 228,165,821 Length adjustment: 114 Effective length of query: 76 Effective length of database: 212,996,753 Effective search space: 16187753228 Effective search space used: 16187753228 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 41 (20.4 bits)