TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= SPP00000647_2.0 # Protein # Methionine-R-sufoxide reductase 3 (SelR3) # Zebrafish (Danio rerio) (186 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01030477.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 77 2e-15 BADN01055509.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 58 8e-09 BADN01030478.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 44 4e-04 BADN01013935.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 40 0.008 >BADN01030477.1 Thunnus orientalis DNA, contig: superscaffoldBa00000683_0018, whole genome shotgun sequence Length = 14015 Score = 77.4 bits (189), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 38/59 (64%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -1 Query: 130 QCGAHLGHLFDDGPRPTKKRYCINSASLSFQPKNSATEEVE--ASGAAGQSSTSKNEEL 186 QCGAHLGHLFDDGPRPT KRYCINSASL+FQPK++A+ A G A S + + EL Sbjct: 6632 QCGAHLGHLFDDGPRPTGKRYCINSASLAFQPKDTASSISSSTAEGEAVSSMSDRKTEL 6456 Score = 65.5 bits (158), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 24 PSGTCRSKKTWPKTFPEEELRKRLTPMQYHVTQQKGTE 61 PSG R+KKTWP +F +EE+RKRLTPMQYHVTQ++GTE Sbjct: 13602 PSGARRTKKTWPVSFSQEEIRKRLTPMQYHVTQERGTE 13489 Score = 62.8 bits (151), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 98 GWPSFFDLINKDAIAQTDDFSYGMHRVETTCSQ 130 GWPSFFDL+ +++I +DDFSYGMHRVETTCSQ Sbjct: 8302 GWPSFFDLMKEESITLSDDFSYGMHRVETTCSQ 8204 Score = 48.1 bits (113), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -1 Query: 54 VTQQKGTESAFTGKYVDNKEEGTYHCVVCGAPLF 87 +T SAF G++ D+K+EGTY CVVCGAPLF Sbjct: 13208 ITNTVFFHSAFAGEFTDHKDEGTYACVVCGAPLF 13107 >BADN01055509.1 Thunnus orientalis DNA, contig: superscaffoldBa00001764_0008, whole genome shotgun sequence Length = 16368 Score = 58.2 bits (139), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +1 Query: 130 QCGAHLGHLFDDGPRPTKKRYCINSASLSFQPKNSATEE 168 QC +HLGH+FDDGP PT +R+CINS +L+F+P+ E Sbjct: 11617 QCDSHLGHVFDDGPDPTGQRFCINSVALTFKPREDNNSE 11733 >BADN01030478.1 Thunnus orientalis DNA, contig: superscaffoldBa00000683_0019, whole genome shotgun sequence Length = 15790 Score = 44.3 bits (103), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -3 Query: 1 MSGFNLLHLVSQGQPVKLKACGLPSG 26 MSGFNLLHLV++ QPV L++C LP+G Sbjct: 2510 MSGFNLLHLVTKSQPVTLRSCSLPTG 2433 >BADN01013935.1 Thunnus orientalis DNA, contig: superscaffoldBa00000232_0021, whole genome shotgun sequence Length = 10275 Score = 40.4 bits (93), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 32/54 (59%) Frame = +3 Query: 75 GTYHCVVCGAPLFMSEKKFDSGSGWPSFFDLINKDAIAQTDDFSYGMHRVETTC 128 G Y C CG LF S KF+ S WP+F + I+KD++++ + ++G +V C Sbjct: 3195 GIYVCSECGHKLFSSLSKFEHSSPWPAFSETIHKDSVSKHPE-AWGPIKVNYHC 3353 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.314 0.130 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 168,588,189 Number of extensions: 2538212 Number of successful extensions: 7640 Number of sequences better than 1.0e-02: 4 Number of HSP's gapped: 7638 Number of HSP's successfully gapped: 7 Length of query: 186 Length of database: 228,165,821 Length adjustment: 114 Effective length of query: 72 Effective length of database: 212,996,753 Effective search space: 15335766216 Effective search space used: 15335766216 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 41 (20.4 bits)