TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= tr|E9QHL7|E9QHL7_DANRE Uncharacterized protein OS=Danio rerio GN=msrb1a PE=4 SV=1 (148 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01013935.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 119 1e-30 BADN01040629.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 80 4e-17 >BADN01013935.1 Thunnus orientalis DNA, contig: superscaffoldBa00000232_0021, whole genome shotgun sequence Length = 10275 Score = 119 bits (298), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 68/144 (47%), Positives = 81/144 (56%), Gaps = 55/144 (38%) Frame = +2 Query: 16 FESGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSK------------QEERWG 63 + SGMY+C++C ++LFSSRSKYEHSSPWPAFTETIHE+SVSK +E+R+ Sbjct: 725 YSSGMYICSKCDHQLFSSRSKYEHSSPWPAFTETIHEESVSKHEERPGAYKVPSEEKRFT 904 Query: 64 -------------------------------------------AYKVRCGKCGNGLGHEF 80 ++VRCGKCGNGLGHEF Sbjct: 905 FLIIESFRGSSV*TYYIHF*TSHHTLSYLNTQLKQLIVVCVLFLFQVRCGKCGNGLGHEF 1084 Query: 81 VNDGPKHGLSRFCIFSSSLKFIPK 104 VNDGP G SRF IFSSSLKF+PK Sbjct: 1085VNDGPGRGQSRF*IFSSSLKFVPK 1156 Score = 90.1 bits (222), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 43/64 (67%), Positives = 52/64 (81%) Frame = +2 Query: 4 CSFSGGEIYKDHFESGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSKQEERWG 63 C+F + + SGMY+C++C ++LFSSRSKYEHSSPWPAFTETIHE+SVSK EER G Sbjct: 689 CTF*HQPLSPILYSSGMYICSKCDHQLFSSRSKYEHSSPWPAFTETIHEESVSKHEERPG 868 Query: 64 AYKV 67 AYKV Sbjct: 869 AYKV 880 Score = 81.3 bits (199), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +3 Query: 18 SGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSKQEERWGAYKVR 68 SG+YVC++CG++LFSS SK+EHSSPWPAF+ETIH+DSVSK E WG KV Sbjct: 3192 SGIYVCSECGHKLFSSLSKFEHSSPWPAFSETIHKDSVSKHPEAWGPIKVN 3344 Score = 67.8 bits (164), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 66 KVRCGKCGNGLGHEFVNDGPKHGLSRFCIFSSSLKFIPK 104 +V CGKCGNGLGHEF+NDGP+ GLSRF IFSSSL FIPK Sbjct: 3491 QVCCGKCGNGLGHEFLNDGPREGLSRF*IFSSSLTFIPK 3607 >BADN01040629.1 Thunnus orientalis DNA, contig: superscaffoldBa00001062_0012, whole genome shotgun sequence Length = 19958 Score = 80.5 bits (197), Expect = 4e-17, Method: Composition-based stats. Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -3 Query: 16 FESGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSKQEERWGAYKVR 68 F +GMYVC++C + LFSSRSK+ HSSPWPAFT TI EDSV+K E A+KVR Sbjct: 13524 FPAGMYVCSKCNHPLFSSRSKFAHSSPWPAFTNTIREDSVTKMMETLTAFKVR 13366 Score = 66.6 bits (161), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 66 KVRCGKCGNGLGHEFVNDGPKHGLSRFCIFSSSLKFIPKE 105 +V CGKCGNGLGHEFVNDGP+ G+SRF IFS SLKF+P + Sbjct: 13244 QVLCGKCGNGLGHEFVNDGPEEGVSRF*IFSHSLKFVPNK 13125 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.320 0.136 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 180,652,006 Number of extensions: 3430519 Number of successful extensions: 13906 Number of sequences better than 1.0e-02: 2 Number of HSP's gapped: 13905 Number of HSP's successfully gapped: 6 Length of query: 148 Length of database: 228,165,821 Length adjustment: 109 Effective length of query: 39 Effective length of database: 213,662,063 Effective search space: 8332820457 Effective search space used: 8332820457 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 40 (20.0 bits)