TBLASTN 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= tr|F1QNX6|F1QNX6_DANRE Glutathione peroxidase OS=Danio rerio GN=gpx8 PE=3 SV=1 (210 letters) Database: genome.fa 133,062 sequences; 684,497,465 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BADN01071155.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 157 4e-43 BADN01103388.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 107 2e-25 BADN01071156.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 89 2e-19 BADN01004052.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 50 5e-06 BADN01015002.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 50 7e-06 BADN01103387.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 42 0.003 BADN01049899.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 37 0.004 BADN01052654.1 Thunnus orientalis DNA, contig: superscaffoldBa00... 41 0.006 >BADN01071155.1 Thunnus orientalis DNA, contig: superscaffoldBa00002749_0006, whole genome shotgun sequence Length = 3280 Score = 157 bits (398), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 73/99 (73%), Positives = 84/99 (84%) Frame = +1 Query: 69 KVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAFAK 128 + SLVVNVAS SE TE SYR+LQELHRELGTSHFNVLAFPC Q+GDTE+GTSR+IEAFAK Sbjct: 1903 QASLVVNVASHSEQTETSYRSLQELHRELGTSHFNVLAFPCGQFGDTETGTSRDIEAFAK 2082 Query: 129 SNYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKIPKWNF 167 S YGVTFP F+KIKIMGSEA PAF+FLT + + ++ Sbjct: 2083 STYGVTFPFFSKIKIMGSEANPAFKFLTGRLTHLSAVHY 2199 Score = 97.4 bits (241), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 47/70 (67%), Positives = 57/70 (81%) Frame = +2 Query: 1 MEALGGYPSKSSASRAGLFKVLLSVALCMGSLYLLQNKLSKSRKTKDFYSYEVKDARGRT 60 MEALGGYP+KSS +A VLLS+ + +G L+LLQ +L K RK KDFYS++VKDA+GRT Sbjct: 1526 MEALGGYPAKSSNPKAKRLTVLLSMTVGVGCLFLLQTQLLKPRKPKDFYSFDVKDAKGRT 1705 Query: 61 VSLEKYRGKV 70 VSLEKYRGKV Sbjct: 1706 VSLEKYRGKV 1735 >BADN01103388.1 Thunnus orientalis DNA, contig: superscaffoldBa00006370_0006, whole genome shotgun sequence Length = 8336 Score = 107 bits (266), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 46/100 (46%), Positives = 69/100 (69%) Frame = +2 Query: 70 VSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAFAKS 129 VSLVVNVAS TE+ Y+ LQ+LHR+ G HFNVLAFPC+Q+G E G+ +EI++F + Sbjct: 5564 VSLVVNVASECGFTEEHYKDLQQLHRDFGPYHFNVLAFPCNQFGQQEPGSDKEIDSFVRR 5743 Query: 130 NYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKIPKWNFWK 169 YGV+FP+F+KI ++G+ A +++L P + ++ Sbjct: 5744 VYGVSFPLFSKIAVVGTGANNVYKYLVGESAAAPLFKAYR 5863 Score = 57.4 bits (137), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = +1 Query: 151 AFRFL----TDSVQKIPKWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLVRNIILKK 206 +F FL +S K P WNFWK+L+ G+VV W P+ V +IR + +VR IILKK Sbjct: 6784 SFDFLL*SFAESAGKEPDWNFWKYLIDVNGKVVDAWGPKVSVKEIRPKIAEMVRQIILKK 6963 Query: 207 RQEL 210 ++EL Sbjct: 6964 KEEL 6975 >BADN01071156.1 Thunnus orientalis DNA, contig: superscaffoldBa00002749_0007, whole genome shotgun sequence Length = 5226 Score = 89.4 bits (220), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +2 Query: 154 FLTDSVQKIPKWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLVRNIILKKRQEL 210 + +DSV+KIPKWNFWKFLV+PEG+VVRFW+ +EP+ +R+E + LVR IILKKR EL Sbjct: 29 YFSDSVKKIPKWNFWKFLVNPEGKVVRFWRADEPMESVRQEVSALVREIILKKRVEL 199 >BADN01004052.1 Thunnus orientalis DNA, contig: superscaffoldBa00000050_0010, whole genome shotgun sequence Length = 8699 Score = 50.4 bits (119), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 5/131 (3%) Frame = +2 Query: 24 SVALCMGSLYLLQNKLSKSRKTKDFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELT 83 S+ L + S N S + FY VK G T SL +GKV L+ NVAS T Sbjct: 3383 SLVLFLWSSGFTSNPESVRMAVRRFYDLTVKLLSGETFSLSALKGKVVLIENVASL*GTT 3562 Query: 84 EQSYRALQELHRELGTSHFNVLAFPCSQYG-----DTESGTSREIEAFAKSNYGVTFPIF 138 + Y + ELH +L PC+Q+G + +SG R + + + Y + + I Sbjct: 3563 TRDYTQMNELHSRYSDKGLVILGVPCNQFGHQVGHEFKSGLQRPVFPWQEIIY-IVYKIG 3739 Query: 139 NKIKIMGSEAE 149 + I+ S A+ Sbjct: 3740 TVLFIIVSTAQ 3772 >BADN01015002.1 Thunnus orientalis DNA, contig: superscaffoldBa00000253_0034, whole genome shotgun sequence Length = 42408 Score = 50.1 bits (118), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 34/68 (50%) Frame = -2 Query: 46 KDFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVL 105 K Y +E K G T + +GKV L+VNVAS T + Y + ELH +L Sbjct: 19238 KKIYDFEAKLLTGETFNFSTLQGKVVLIVNVASL*GTTTRDYTQMNELHERYAGKGLVIL 19059 Query: 106 AFPCSQYG 113 PC+Q+G Sbjct: 19058 GVPCNQFG 19035 >BADN01103387.1 Thunnus orientalis DNA, contig: superscaffoldBa00006370_0005, whole genome shotgun sequence Length = 3405 Score = 42.0 bits (97), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = +1 Query: 44 KTKDFYSYEVKDARGRTVSLEKYRGKVSLVV 74 K KDFY+++V ++RG+ VSLEKYRG VS + Sbjct: 1021 KQKDFYTFKVVNSRGKLVSLEKYRGSVSFLC 1113 >BADN01049899.1 Thunnus orientalis DNA, contig: superscaffoldBa00001481_0015, whole genome shotgun sequence Length = 8171 Score = 37.4 bits (85), Expect(2) = 0.004, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = -2 Query: 66 YRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTS 120 +RG V ++ NVAS T +Y ++H + ++LAFP +Q+G+ TS Sbjct: 5083 FRGNVVIITNVASK*GKTPVNYSQFTQMHAKYAERGLHILAFPSNQFGNQVHFTS 4919 Score = 24.3 bits (51), Expect(2) = 0.004, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 49 YSYEVKDARGRTVSLEKYR 67 Y + D G VSLEKYR Sbjct: 5238 YDFSATDIDGNLVSLEKYR 5182 >BADN01052654.1 Thunnus orientalis DNA, contig: superscaffoldBa00001620_0011, whole genome shotgun sequence Length = 10871 Score = 41.2 bits (95), Expect = 0.006, Method: Compositional matrix adjust. Identities = 30/122 (24%), Positives = 43/122 (35%), Gaps = 39/122 (31%) Frame = -3 Query: 43 RKTKDFYSYEVKDARGRTVSLEKY------------------------------------ 66 + K Y + KD G VSLEKY Sbjct: 3936 QSAKSIYEFSAKDIDGNEVSLEKYK*TYMYPLKLKLHTNLEEVFCRFFFFFSV*RLLFLI 3757 Query: 67 ---RGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREI 123 RG V ++VNVAS T+ +Y L +H ++ FPC+Q+G + + I Sbjct: 3756 FSARGYVCIIVNVASK*GKTKVNYTQLAGMHASYAEKGLRIMGFPCNQFGGQVT*NNLMI 3577 Query: 124 EA 125 A Sbjct: 3576 TA 3571 Database: genome.fa Posted date: Oct 9, 2014 7:00 PM Number of letters in database: 684,497,465 Number of sequences in database: 133,062 Lambda K H 0.317 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 133062 Number of Hits to DB: 140,776,414 Number of extensions: 1720891 Number of successful extensions: 7469 Number of sequences better than 1.0e-02: 9 Number of HSP's gapped: 7467 Number of HSP's successfully gapped: 13 Length of query: 210 Length of database: 228,165,821 Length adjustment: 116 Effective length of query: 94 Effective length of database: 212,730,629 Effective search space: 19996679126 Effective search space used: 19996679126 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 41 (20.4 bits)