SPPGPx1b_Danio gi|371559413|gb|JH584420.1| 76.79 112 26 0 27 138 870278 870613 2e-46 186 SPPGPx1b_Danio gi|371559183|gb|JH584650.1| 58.73 63 26 0 80 142 3168940 3169128 5e-17 88.6 SPPGPx1b_Danio gi|371559183|gb|JH584650.1| 66.04 53 18 0 26 78 3167778 3167936 7e-14 78.2 SPPGPx1b_Danio gi|371559166|gb|JH584667.1| 44.68 47 26 0 88 134 1127758 1127618 1e-04 47.8 SPPGPx1b_Danio gi|371559166|gb|JH584667.1| 55.88 34 15 0 39 72 1128009 1127908 3e-04 46.2 SPPGPx1b_Danio gi|371559115|gb|JH584718.1| 36.62 71 45 2 1 71 653297 653100 7e-04 45.1 TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPPGPx1b_Danio (142 letters) Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/genom e.fa 80,983 sequences; 2,589,728,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold ... 186 2e-46 gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold ... 89 5e-17 gb|JH584667.1| Chrysemys picta bellii unplaced genomic scaffold ... 48 1e-04 gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold ... 45 7e-04 >gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold Group31, whole genome shotgun sequence Length = 981918 Score = 186 bits (471), Expect = 2e-46 Identities = 86/112 (76%), Positives = 95/112 (84%) Frame = +2 Query: 27 ENCTNEEILLSLKYVRPGNGYEPKFQLLEKVDVNGKNAHPLFTFLKEKLPFPSDEPMPFM 86 EN TNEEILLSLK+VRPGNGYEP F + EK DVNG NAHPLFTFLKE LPFP D+PM M Sbjct: 870278 ENATNEEILLSLKHVRPGNGYEPNFTMFEKCDVNGANAHPLFTFLKEALPFPHDDPMSLM 870457 Query: 87 SDPKFIIWSPVCRNDIAWNFEKFLIGSDGVPFKRYSRRFLTSGIDGDIKKLL 138 ++P++IIWSPVCRNDI+WNFEKFLIG DGVPFKRYSR F T I DI+KLL Sbjct: 870458 TNPQYIIWSPVCRNDISWNFEKFLIGRDGVPFKRYSRHFETIKIQDDIEKLL 870613 >gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold Group261, whole genome shotgun sequence Length = 5063696 Score = 88.6 bits (218), Expect = 5e-17 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = +1 Query: 80 DEPMPFMSDPKFIIWSPVCRNDIAWNFEKFLIGSDGVPFKRYSRRFLTSGIDGDIKKLLS 139 DEP M DPKF++WSPV R+D++WNFEKFL+G +G PFKRYS +F T I+ DI++LL Sbjct: 3168940 DEPSALMGDPKFVVWSPVRRDDLSWNFEKFLVGPEGEPFKRYSPKFQTIAIEPDIQRLLK 3169119 Query: 140 IPK 142 + K Sbjct: 3169120 LTK 3169128 Score = 78.2 bits (191), Expect = 7e-14 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = +3 Query: 26 QENCTNEEILLSLKYVRPGNGYEPKFQLLEKVDVNGKNAHPLFTFLKEKLPFP 78 QENCTNEEIL SLKYVRPG G+EP F L +K VNG + HP+F +LK LP P Sbjct: 3167778 QENCTNEEILNSLKYVRPGAGFEPNFTLFQKCQVNGPDVHPVFAYLKAHLPTP 3167936 >gb|JH584667.1| Chrysemys picta bellii unplaced genomic scaffold Group278, whole genome shotgun sequence Length = 5394641 Score = 47.8 bits (112), Expect = 1e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = -2 Query: 88 DPKFIIWSPVCRNDIAWNFEKFLIGSDGVPFKRYSRRFLTSGIDGDI 134 DPK + W P+ +DI WNFEKFL+G G P R+ R + + DI Sbjct: 1127758 DPKRLFWEPLKIHDIKWNFEKFLVGPTGRPVMRWGPRTNLAVVKNDI 1127618 Score = 46.2 bits (108), Expect = 3e-04 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = -3 Query: 39 KYVRPGNGYEPKFQLLEKVDVNGKNAHPLFTFLK 72 +YVRPG G+ P FQL +K DVNG+ +TFLK Sbjct: 1128009 RYVRPGGGFVPNFQLFQKGDVNGEEEQKFYTFLK 1127908 >gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold Scfld59, whole genome shotgun sequence Length = 6178864 Score = 45.1 bits (105), Expect = 7e-04 Identities = 26/71 (36%), Positives = 33/71 (46%) Frame = -3 Query: 1 MNELHERFAEKGLVVLGVPCNQFGYQENCTNEEILLSLKYVRPGNGYEPKFQLLEKVDVN 60 + ELH F VL PCNQFG E +++EI K GN Y F + K+ + Sbjct: 653297 LQELHREFGPSHFTVLAFPCNQFGELEPSSSQEIESFAK----GN-YGATFPIFHKIKIL 653133 Query: 61 GKNAHPLFTFL 71 G P F FL Sbjct: 653132 GSETEPAFKFL 653100 Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/gen ome.fa Posted date: Oct 24, 2012 8:30 PM Number of letters in database: 2,589,728,838 Number of sequences in database: 80,983 Lambda K H 0.322 0.143 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 524,953,223 Number of Sequences: 80983 Number of extensions: 9267113 Number of successful extensions: 38357 Number of sequences better than 1.0e-03: 4 Number of HSP's better than 0.0 without gapping: 3407 Number of HSP's successfully gapped in prelim test: 456 Number of HSP's that attempted gapping in prelim test: 6873 Number of HSP's gapped (non-prelim): 34825 length of query: 142 length of database: 863,242,946 effective HSP length: 116 effective length of query: 26 effective length of database: 853,848,918 effective search space: 22200071868 effective search space used: 22200071868 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 104 (44.7 bits)