SPPSelT_gallus gi|371559318|gb|JH584515.1| 81.67 60 11 1 84 143 20607 20780 1e-19 99.0 SPPSelT_gallus gi|371559318|gb|JH584515.1| 89.58 48 5 0 152 199 27348 27491 1e-16 89.0 SPPSelT_gallus gi|371559318|gb|JH584515.1| 97.30 37 1 0 51 87 19284 19394 6e-13 76.6 SPPSelT_gallus gi|371559318|gb|JH584515.1| 100.00 29 0 0 130 158 23432 23518 7e-09 63.2 TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPPSelT_gallus (199 letters) Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/genom e.fa 80,983 sequences; 2,589,728,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|JH584515.1| Chrysemys picta bellii unplaced genomic scaffold ... 99 1e-19 >gb|JH584515.1| Chrysemys picta bellii unplaced genomic scaffold Group126, whole genome shotgun sequence Length = 6499924 Score = 99.0 bits (245), Expect = 1e-19 Identities = 49/60 (81%), Positives = 52/60 (86%) Frame = +3 Query: 84 PIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMI 143 P RHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKV+ +FF SN + Sbjct: 20607 PFDRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVH--HFLFFKSNFL 20780 Score = 89.0 bits (219), Expect = 1e-16 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = +3 Query: 152 AFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMESMPHHRS 199 AF L DVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMESM HHRS Sbjct: 27348 AFSFFLLDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMESMHHHRS 27491 Score = 76.6 bits (187), Expect = 6e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 51 VSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYR 87 VS GYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYR Sbjct: 19284 VS*GYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYR 19394 Score = 63.2 bits (152), Expect = 7e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 130 VYACMMVFFLSNMIENQCMSTGAFEITLN 158 VYACMMVFFLSNMIENQCMSTGAFEITLN Sbjct: 23432 VYACMMVFFLSNMIENQCMSTGAFEITLN 23518 Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/gen ome.fa Posted date: Oct 24, 2012 8:30 PM Number of letters in database: 2,589,728,838 Number of sequences in database: 80,983 Lambda K H 0.325 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 574,133,825 Number of Sequences: 80983 Number of extensions: 8125606 Number of successful extensions: 44040 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 2493 Number of HSP's successfully gapped in prelim test: 395 Number of HSP's that attempted gapping in prelim test: 12547 Number of HSP's gapped (non-prelim): 38093 length of query: 199 length of database: 863,242,946 effective HSP length: 124 effective length of query: 75 effective length of database: 853,201,054 effective search space: 63990079050 effective search space used: 63990079050 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 125 (52.8 bits)