SPPGPx3_human gi|371559166|gb|JH584667.1| 62.69 67 25 0 152 218 1127797 1127597 4e-35 99.4 SPPGPx3_human gi|371559166|gb|JH584667.1| 63.46 52 19 0 29 80 1129988 1129833 3e-13 78.2 SPPGPx3_human gi|371559166|gb|JH584667.1| 91.18 34 3 0 120 153 1128009 1127908 4e-35 72.4 SPPGPx3_human gi|371559166|gb|JH584667.1| 82.50 40 7 0 81 120 1129203 1129084 6e-11 70.5 SPPGPx3_human gi|371559413|gb|JH584420.1| 42.59 108 58 1 108 211 870278 870601 5e-18 94.0 SPPGPx3_human gi|371559115|gb|JH584718.1| 38.04 92 56 2 62 152 653360 653100 9e-07 56.6 SPPGPx3_human gi|371559183|gb|JH584650.1| 46.05 76 40 3 36 110 3166085 3166306 1e-06 55.8 SPPGPx3_human gi|371559183|gb|JH584650.1| 51.92 52 25 0 106 157 3167775 3167930 2e-06 55.5 TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPPGPx3_human (226 letters) Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/genom e.fa 80,983 sequences; 2,589,728,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|JH584667.1| Chrysemys picta bellii unplaced genomic scaffold ... 99 4e-35 gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold ... 94 5e-18 gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold ... 57 9e-07 gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold ... 56 1e-06 >gb|JH584667.1| Chrysemys picta bellii unplaced genomic scaffold Group278, whole genome shotgun sequence Length = 5394641 Score = 99.4 bits (246), Expect(2) = 4e-35 Identities = 42/67 (62%), Positives = 52/67 (77%) Frame = -2 Query: 152 LKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDI 211 L+NSCPP E G RLFWEP+K+HDI+WNFEKFLVGP G P+MRW RT ++ VK DI Sbjct: 1127797 LQNSCPPVVESFGDPKRLFWEPLKIHDIKWNFEKFLVGPTGRPVMRWGPRTNLAVVKNDI 1127618 Query: 212 LSYMRRQ 218 + YM+R+ Sbjct: 1127617 VDYMKRR 1127597 Score = 78.2 bits (191), Expect = 3e-13 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = -1 Query: 29 KMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI 80 ++DC+ + GTIY+YGA+TIDG+EYIPF +Y GK +LFVNVA+Y GLT QY+ Sbjct: 1129988 QVDCYNSVEGTIYKYGAVTIDGQEYIPFGKYKGKMILFVNVATY*GLTMQYL 1129833 Score = 72.4 bits (176), Expect(2) = 4e-35 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 120 KYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLK 153 +YVRPGGGFVPNFQLF+KGDVNGE+EQKFYTFLK Sbjct: 1128009 RYVRPGGGFVPNFQLFQKGDVNGEEEQKFYTFLK 1127908 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 81 ELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK 120 ELNALQ+ELAP GLVIL FP NQFGKQEPG+N+EILP LK Sbjct: 1129203 ELNALQKELAPHGLVILAFPSNQFGKQEPGDNAEILPALK 1129084 >gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold Group31, whole genome shotgun sequence Length = 981918 Score = 94.0 bits (232), Expect = 5e-18 Identities = 46/108 (42%), Positives = 61/108 (56%), Gaps = 4/108 (3%) Frame = +2 Query: 108 EPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCP----PTSELL 163 E N EIL +LK+VRPG G+ PNF +FEK DVNG +TFLK + P L+ Sbjct: 870278 ENATNEEILLSLKHVRPGNGYEPNFTMFEKCDVNGANAHPLFTFLKEALPFPHDDPMSLM 870457 Query: 164 GTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDI 211 + W P+ +DI WNFEKFL+G DG+P R+ ++ DI Sbjct: 870458 TNPQYIIWSPVCRNDISWNFEKFLIGRDGVPFKRYSRHFETIKIQDDI 870601 >gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold Scfld59, whole genome shotgun sequence Length = 6178864 Score = 56.6 bits (135), Expect = 9e-07 Identities = 35/92 (38%), Positives = 45/92 (48%), Gaps = 1/92 (1%) Frame = -3 Query: 62 KYVLFVNVASYUGLTGQ-YIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK 120 K L VNVASY T + YI L L E P +L FPCNQFG+ EP + EI K Sbjct: 653360 KASLVVNVASYCQHTDKNYIALQELHREFGPSHFTVLAFPCNQFGELEPSSSQEIESFAK 653181 Query: 121 YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFL 152 G + F +F K + G + + + FL Sbjct: 653180 -----GNYGATFPIFHKIKILGSETEPAFKFL 653100 >gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold Group261, whole genome shotgun sequence Length = 5063696 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = +2 Query: 36 ISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQ-YIELNALQEELAPFGL 94 I+ + Y+ A I GE+ + F + G+ VL NVAS G T + Y +LN LQ P L Sbjct: 3166085 IAKSFYDLSATDIHGEK-VDFNNFRGRVVLIENVASL*GTTVRDYTQLNQLQARY-PRRL 3166258 Query: 95 VILGFPCNQFGKQEPG 110 V+LGFPCNQFG Q G Sbjct: 3166259 VVLGFPCNQFGYQVCG 3166306 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +3 Query: 106 KQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCP 157 +QE N EIL +LKYVRPG GF PNF LF+K VNG + +LK P Sbjct: 3167775 RQENCTNEEILNSLKYVRPGAGFEPNFTLFQKCQVNGPDVHPVFAYLKAHLP 3167930 Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/gen ome.fa Posted date: Oct 24, 2012 8:30 PM Number of letters in database: 2,589,728,838 Number of sequences in database: 80,983 Lambda K H 0.320 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 685,654,054 Number of Sequences: 80983 Number of extensions: 10473050 Number of successful extensions: 39816 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2497 Number of HSP's successfully gapped in prelim test: 424 Number of HSP's that attempted gapping in prelim test: 11887 Number of HSP's gapped (non-prelim): 34032 length of query: 226 length of database: 863,242,946 effective HSP length: 126 effective length of query: 100 effective length of database: 853,039,088 effective search space: 85303908800 effective search space used: 85303908800 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 126 (53.1 bits)