SPPGPx3_gallus gi|371559395|gb|JH584438.1| 78.18 55 12 0 7 61 128981 128817 7e-17 88.2 SPPGPx3_gallus gi|371559395|gb|JH584438.1| 70.83 48 14 0 52 99 128119 127976 6e-15 81.6 SPPGPx3_gallus gi|371559346|gb|JH584487.1| 45.35 86 46 1 10 94 6097393 6097650 6e-13 75.1 SPPGPx3_gallus gi|371559115|gb|JH584718.1| 41.67 84 48 1 12 94 653351 653100 4e-12 72.4 SPPGPx3_gallus gi|371559183|gb|JH584650.1| 51.72 58 28 1 1 58 3166136 3166306 2e-06 53.5 SPPGPx3_gallus gi|371559413|gb|JH584420.1| 49.12 57 29 1 1 57 867998 868165 2e-06 53.1 TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPPGPx3_gallus (101 letters) Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/genom e.fa 80,983 sequences; 2,589,728,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|JH584438.1| Chrysemys picta bellii unplaced genomic scaffold ... 88 7e-17 gb|JH584487.1| Chrysemys picta bellii unplaced genomic scaffold ... 75 6e-13 gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold ... 72 4e-12 gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold ... 54 2e-06 gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold ... 53 2e-06 >gb|JH584438.1| Chrysemys picta bellii unplaced genomic scaffold Group49, whole genome shotgun sequence Length = 9859369 Score = 88.2 bits (217), Expect = 7e-17 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = -3 Query: 7 RGFVCIITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEPGDDA 61 RG VCIITNVASK GKT VNYTQLVD++ARYAE+GLRIL FPCNQFG Q G A Sbjct: 128981 RGNVCIITNVASK*GKTDVNYTQLVDMYARYAERGLRILGFPCNQFGNQVGGTSA 128817 Score = 81.6 bits (200), Expect = 6e-15 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 52 FGKQEPGDDAQIKAFAEGYGVKFDMFSKIEVNGDGAHPLWKWLKEQPK 99 F EPGD++QIK F YGVKFDM+SKIEVNG+ AHPLWKW+K+QPK Sbjct: 128119 FAS*EPGDESQIKQFVASYGVKFDMYSKIEVNGNNAHPLWKWMKDQPK 127976 >gb|JH584487.1| Chrysemys picta bellii unplaced genomic scaffold Group98, whole genome shotgun sequence Length = 15338546 Score = 75.1 bits (183), Expect = 6e-13 Identities = 39/86 (45%), Positives = 53/86 (61%), Gaps = 1/86 (1%) Frame = +1 Query: 10 VCIITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEPGDDAQIKAFA-E 68 V ++ NVAS+ G T +Y L L +LAFPCNQFG+QEP + +I++FA + Sbjct: 6097393 VSLVVNVASECGFTDSHYKALQQLQRDLGSHHFNVLAFPCNQFGQQEPDSNKEIESFARK 6097572 Query: 69 GYGVKFDMFSKIEVNGDGAHPLWKWL 94 YG F MFSKI V G GA+ +K+L Sbjct: 6097573 TYGASFPMFSKIAVTGAGANAAFKYL 6097650 >gb|JH584718.1| Chrysemys picta bellii unplaced genomic scaffold Scfld59, whole genome shotgun sequence Length = 6178864 Score = 72.4 bits (176), Expect = 4e-12 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = -3 Query: 12 IITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEPGDDAQIKAFAEG-Y 70 ++ NVAS T NY L +LH + +LAFPCNQFG+ EP +I++FA+G Y Sbjct: 653351 LVVNVASYCQHTDKNYIALQELHREFGPSHFTVLAFPCNQFGELEPSSSQEIESFAKGNY 653172 Query: 71 GVKFDMFSKIEVNGDGAHPLWKWL 94 G F +F KI++ G P +K+L Sbjct: 653171 GATFPIFHKIKILGSETEPAFKFL 653100 >gb|JH584650.1| Chrysemys picta bellii unplaced genomic scaffold Group261, whole genome shotgun sequence Length = 5063696 Score = 53.5 bits (127), Expect = 2e-06 Identities = 30/58 (51%), Positives = 35/58 (60%) Frame = +2 Query: 1 VSLEQYRGFVCIITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEPG 58 V +RG V +I NVAS G T +YTQL L ARY + L +L FPCNQFG Q G Sbjct: 3166136 VDFNNFRGRVVLIENVASL*GTTVRDYTQLNQLQARYPRR-LVVLGFPCNQFGYQVCG 3166306 >gb|JH584420.1| Chrysemys picta bellii unplaced genomic scaffold Group31, whole genome shotgun sequence Length = 981918 Score = 53.1 bits (126), Expect = 2e-06 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = +2 Query: 1 VSLEQYRGFVCIITNVASKUGKTAVNYTQLVDLHARYAEKGLRILAFPCNQFGKQEP 57 ++L G V +++NVAS G TA ++ QL +L RY GL +LAFPCNQFG Q P Sbjct: 867998 LALGSLLGRVLLVSNVASL*GTTARDFAQLSELQRRYGS-GLAVLAFPCNQFGHQVP 868165 Database: /cursos/BI/genomes/project_2013/Chrysemys_picta_bellii/gen ome.fa Posted date: Oct 24, 2012 8:30 PM Number of letters in database: 2,589,728,838 Number of sequences in database: 80,983 Lambda K H 0.320 0.138 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 315,389,030 Number of Sequences: 80983 Number of extensions: 3226605 Number of successful extensions: 17019 Number of sequences better than 1.0e-05: 5 Number of HSP's better than 0.0 without gapping: 2303 Number of HSP's successfully gapped in prelim test: 164 Number of HSP's that attempted gapping in prelim test: 5832 Number of HSP's gapped (non-prelim): 13917 length of query: 101 length of database: 863,242,946 effective HSP length: 76 effective length of query: 25 effective length of database: 857,088,238 effective search space: 21427205950 effective search space used: 21427205950 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 121 (51.2 bits)