TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|8923460|ref|NP_060316.1| tRNA selenocysteine 1-associated protein 1 [Homo sapiens] (287 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5166 7906 13111 84 1e-15 Contig7333 4847 8588 49 2e-05 Contig24342 827 827 41 0.007 Contig9838 4199 4229 39 0.021 Contig2836 13114 15250 39 0.021 Contig2074 15877 23599 38 0.062 Contig11221 2705 3461 37 0.14 Contig8417 4991 17611 34 0.69 Contig4809 6876 6916 34 0.90 Contig3206 11075 16402 33 1.2 Contig53644 373 373 32 3.4 Contig1149 21156 21296 32 4.4 Contig10553 2965 6085 31 5.8 Contig4964 7159 7199 31 5.8 Contig8440 3975 5270 30 9.9 >Contig5166 7906 13111 Length = 13111 Score = 83.6 bits (205), Expect = 1e-15 Identities = 42/84 (50%), Positives = 60/84 (71%) Frame = +3 Query: 4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLH 63 +LW+GD+E +MDE ++ F+ +GE V++VK+IR++ T IP+GY FVEFA ATA K L Sbjct: 2943 TLWVGDIEQWMDETYVMNLFSHVGE-VVNVKLIRDKNTMIPSGYGFVEFASHATAVKILE 3119 Query: 64 KINGKPLPGATPAKRFKLNYATYG 87 NG P+P A + F+LN+AT G Sbjct: 3120 NYNGTPIPNA--GRSFRLNWATMG 3185 Score = 45.8 bits (107), Expect = 2e-04 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +2 Query: 112 LYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQKR 152 L F++ YPS + KVV D TG+SKGYGFV+F DE ++ R Sbjct: 3611 LQNAFIQRYPSVKNAKVVTDPVTGISKGYGFVRFIDENDKNR 3736 Score = 32.3 bits (72), Expect = 2.6 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +2 Query: 93 SPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFT 145 S + +F+G L P+VD+ L F G+++ + SKG GFV+FT Sbjct: 5678 SDKKQIFIGGLDPNVDEDTLRNTFAPF------GELIYVKIPASKGCGFVQFT 5818 >Contig7333 4847 8588 Length = 8588 Score = 49.3 bits (116), Expect = 2e-05 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -3 Query: 92 NSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTDELEQ 150 ++ +Y +F GDL +V D ML F++ YPS + +VV D+ +G SKG+GFV F+D + Sbjct: 615 SADDYRIFCGDLGNEVHDEMLKSAFMR-YPSLQRVRVVRDKKSGKSKGFGFVSFSDPHDF 439 Query: 151 KRALTECQG 159 AL E G Sbjct: 438 VTALREMNG 412 >Contig24342 827 827 Length = 827 Score = 40.8 bits (94), Expect = 0.007 Identities = 26/77 (33%), Positives = 45/77 (58%) Frame = -2 Query: 97 SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTE 156 +L+V +L ++DD L F + + KV+ D SKG+GFV ++ E R++TE Sbjct: 286 NLYVKNLEDNIDDEKLRAEFAP-FGTITSCKVMRDDKINSKGFGFVCYSTPEEATRSVTE 110 Query: 157 CQGAVGLGSKPVRLSVA 173 G + LG+KP+ +++A Sbjct: 109 MNGRI-LGTKPLYVALA 62 >Contig9838 4199 4229 Length = 4229 Score = 39.3 bits (90), Expect = 0.021 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 97 SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGVSKGYGFVKF 144 +L V L + D L + FV VY VV+D TG+SKGYGFVKF Sbjct: 423 NLIVNSLPEGITDDDLVQMFV-VYGDLESASVVVDFATGISKGYGFVKF 280 >Contig2836 13114 15250 Length = 15250 Score = 39.3 bits (90), Expect = 0.021 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 97 SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGVSKGYGFVKF 144 +L V L + D L + FV VY VV+D TG+SKGYGFVKF Sbjct: 314 NLIVNSLPEGITDDDLVQMFV-VYGDLESASVVVDFATGISKGYGFVKF 457 >Contig2074 15877 23599 Length = 23599 Score = 37.7 bits (86), Expect = 0.062 Identities = 27/88 (30%), Positives = 40/88 (45%) Frame = +3 Query: 91 DNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQ 150 D S Y+++VG L DV + L + F P ++ D +G GYGFV F Q Sbjct: 5991 DPSNTYNVYVGGLGNDVTEKDLIDAFQICGPVV-SARIFRDPSGEPMGYGFVHFETRDGQ 6167 Query: 151 KRALTECQGAVGLGSKPVRLSVAIPKAS 178 RAL+E + + K A+ K + Sbjct: 6168 LRALSEEYNHIKVKGKQTLTKPAVEKTT 6251 >Contig11221 2705 3461 Length = 3461 Score = 36.6 bits (83), Expect = 0.14 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +1 Query: 2 AASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLA 56 +ASL++GDL P E + F +G V S+++ R+ +T GY +V F +A Sbjct: 118 SASLYVGDLAPETSEGQLFEVFKNVG-PVASIRVCRDAVTRKSLGYAYVNFHSVA 279 Score = 35.0 bits (79), Expect = 0.40 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 97 SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTE 156 ++F+ +L + L++ F + KV +D G SKGYGFV + ++ + +A+ + Sbjct: 533 NIFIKNLDKSITAAQLHDTF-SAFGKILSCKVEVDNNGASKGYGFVHYENQEDADQAVAK 709 Query: 157 CQG 159 G Sbjct: 710 VNG 718 >Contig8417 4991 17611 Length = 17611 Score = 34.3 bits (77), Expect = 0.69 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 88 KQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGVSKGYGFVK 143 KQP+ + ++FV L D+DD L F + KV++D QTG+S GYG+ K Sbjct: 5291 KQPEFLDQTNVFVKYLPGDIDDEGLRTLFAP-HGEIISSKVMIDHQTGMSLGYGYEK 5458 >Contig4809 6876 6916 Length = 6916 Score = 33.9 bits (76), Expect = 0.90 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 97 SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGVSKGYGFVKF 144 +L+V L ++ D L + F + +V++D T VSKGYGFVKF Sbjct: 311 NLYVNSLPKEITDDKLVQIF-GTFGDIESARVMVDLTTRVSKGYGFVKF 454 >Contig3206 11075 16402 Length = 16402 Score = 33.5 bits (75), Expect = 1.2 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = -1 Query: 15 DENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAE 59 DE + F+T G+ V+ KII +++TG GY FV F D AE Sbjct: 5290 DEAQLESFFSTHGQ-VLECKIIMDKMTGKSKGYGFVTFKDANAAE 5159 Score = 30.4 bits (67), Expect = 9.9 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 108 DDGMLYEFFVKVYPSCRGGKVVLDQ-TGVSKGYGFVKFTD 146 D+ L FF + K+++D+ TG SKGYGFV F D Sbjct: 5290 DEAQLESFF-STHGQVLECKIIMDKMTGKSKGYGFVTFKD 5174 >Contig53644 373 373 Length = 373 Score = 32.0 bits (71), Expect = 3.4 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 133 TGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASR 179 TG SKG+GF + D E A E L ++P+ +S A+ K ++ Sbjct: 179 TGASKGFGFCSY-DNFESSDAAIEAMNGQYLCNRPIHVSYALKKDTK 316 >Contig1149 21156 21296 Length = 21296 Score = 31.6 bits (70), Expect = 4.4 Identities = 20/70 (28%), Positives = 37/70 (52%) Frame = -2 Query: 112 LYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLS 171 LY+ F + + KVV D SKGYGFV F + ++A+++ G + + ++ V + Sbjct: 1000 LYDTF-SAFGNILSCKVVTDDQNQSKGYGFVHFETKEAAEKAISKVNGMM-MHNQKVFVG 827 Query: 172 VAIPKASRVK 181 + + R+K Sbjct: 826 PFVTRKERLK 797 >Contig10553 2965 6085 Length = 6085 Score = 31.2 bits (69), Expect = 5.8 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -3 Query: 1 MAASLWMGDLEPYMDENFISRAFATMGETVMSVK-IIRNRLTGIPAGYCFVEFADLATAE 59 ++ +L++G+L + E I F+ GE + + RN+ T P G+CFVE A Sbjct: 2756 LSTTLYVGNLSFFTTEEQIVELFSKCGEIKRVIMGLDRNKKT--PCGFCFVELYTREDAT 2583 Query: 60 KCL 62 C+ Sbjct: 2582 DCV 2574 >Contig4964 7159 7199 Length = 7199 Score = 31.2 bits (69), Expect = 5.8 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +3 Query: 34 KIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNY 83 KII+++ TG G+ + ++ ++A + +NGK + PA FK+ Y Sbjct: 3549 KIIKDKNTGESKGFAYAKYDKASSAALAIESLNGKKISEDQPA--FKVGY 3692 >Contig8440 3975 5270 Length = 5270 Score = 30.4 bits (67), Expect = 9.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 77 KRFKLNYATYGKQPDNSPEYSLFVGDLTPDV 107 K FK +A P+ SP++ ++VG+L P V Sbjct: 1719 KHFKQEHARTQNDPNESPQFRMYVGNLFPQV 1811 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.317 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,751,712 Number of Sequences: 297657 Number of extensions: 930303 Number of successful extensions: 2615 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2612 length of query: 287 length of database: 106,339,350 effective HSP length: 112 effective length of query: 175 effective length of database: 73,001,766 effective search space: 12775309050 effective search space used: 12775309050 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 67 (30.4 bits)