TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|224465209|ref|NP_699167.2| L-seryl-tRNA(Sec) kinase [Homo sapiens] (348 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1754 19362 42502 52 6e-06 Contig21074 787 787 33 1.6 >Contig1754 19362 42502 Length = 42502 Score = 51.6 bits (122), Expect = 6e-06 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = +2 Query: 173 GFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLEKPNPEKNAWEHNSLTIPS 228 GF Q+ + CP+E C+ RN R +P I M + E P P + WE +++ +PS Sbjct: 32951 GFAQVHVTCPVEECIARNASRTNPVPESIIRDMAERFEVPAPTSHEWERHTIQVPS 33118 >Contig21074 787 787 Length = 787 Score = 33.5 bits (75), Expect = 1.6 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = +3 Query: 23 LCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAFLAG 66 + G P AGKSTF AL L QE+ + V+A D P + L+G Sbjct: 6 ISGAPGAGKSTFIEALGSYLTQEKHHHVAVLAVD---PSSSLSG 128 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.321 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 148,080,381 Number of Sequences: 297657 Number of extensions: 2342245 Number of successful extensions: 9849 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9844 length of query: 348 length of database: 106,339,350 effective HSP length: 114 effective length of query: 234 effective length of database: 72,406,452 effective search space: 16943109768 effective search space used: 16943109768 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 68 (30.8 bits)