TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|224465209|ref|NP_699167.2| L-seryl-tRNA(Sec) kinase [Homo sapiens] (348 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330848697|gb|ADNL01001906.1| Astrammina rara contig02264, who... 24 3.7 gi|330849213|gb|ADNL01001390.1| Astrammina rara contig01649, who... 24 3.7 gi|330850599|gb|ADNL01000004.1| Astrammina rara contig00005, who... 23 6.2 gi|330850579|gb|ADNL01000024.1| Astrammina rara contig00025, who... 23 8.1 >gi|330848697|gb|ADNL01001906.1| Astrammina rara contig02264, whole genome shotgun sequence Length = 174 Score = 24.3 bits (51), Expect = 3.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 25 GLPAAGKSTFARALAHRLQQEQGW 48 G+P++GKS F + Q GW Sbjct: 45 GIPSSGKSDFVDQMVVGYNQNYGW 116 >gi|330849213|gb|ADNL01001390.1| Astrammina rara contig01649, whole genome shotgun sequence Length = 160 Score = 24.3 bits (51), Expect = 3.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 321 GNEHIKCRSAKVGWLQCCRIE 341 G H+ C + WL CRIE Sbjct: 98 GLYHLTCCKSTATWLSICRIE 160 >gi|330850599|gb|ADNL01000004.1| Astrammina rara contig00005, whole genome shotgun sequence Length = 288 Score = 23.5 bits (49), Expect = 6.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -2 Query: 198 PPETIHLMGRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVT 240 P + L+ L PNP N +PSP A A + T Sbjct: 287 PRVVLGLLALNLSPPNPHMNFAPPGLKNVPSPVSALTAPV*TT 159 >gi|330850579|gb|ADNL01000024.1| Astrammina rara contig00025, whole genome shotgun sequence Length = 991 Score = 23.1 bits (48), Expect = 8.1 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 135 YLLTKTAVSRPLFLVLD-DNFYYQSMRYEVYQ 165 YLL+ A+S PLF D NF S R+ +Y+ Sbjct: 229 YLLSLYALSHPLFFARDLSNF---SFRFPLYK 143 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.321 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 654,473 Number of Sequences: 3231 Number of extensions: 8957 Number of successful extensions: 30 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of query: 348 length of database: 483,365 effective HSP length: 75 effective length of query: 273 effective length of database: 241,040 effective search space: 65803920 effective search space used: 65803920 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)