TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|74553663|sp|Q6LX62.1|PSTK_METMP RecName: Full=L-seryl-tRNA(Sec) kinase; AltName: Full=O-phosphoseryl-tRNA(Sec) kinase; Short=PSTK (255 letters) Database: P.capsici/genome.fa 917 sequences; 64,023,748 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PHYCAscaffold_11 29 5.6 PHYCAscaffold_61 29 7.3 >PHYCAscaffold_11 Length = 1076090 Score = 29.3 bits (64), Expect = 5.6 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 2 LIILTGLPSVGKSTFSKAFSKKM 24 L++L G+P GKS+F +A SK++ Sbjct: 677938 LLVLCGIPGSGKSSFRRALSKRI 678006 >PHYCAscaffold_61 Length = 347729 Score = 28.9 bits (63), Expect = 7.3 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -2 Query: 63 KEALENKFSVIVDDTNYYNSKRRDLMNIAKECDTNYVTIYLKAPLNLLLKR 113 KE ++++ + N +NS R+ + +A +TN +Y K N++L+R Sbjct: 49669 KERRTKSYTIV--NVNEFNSTRKRMSVVAVNDETNEYVLYCKGADNMMLER 49523 Database: P.capsici/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 64,023,748 Number of sequences in database: 917 Lambda K H 0.315 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,698,187 Number of Sequences: 917 Number of extensions: 97635 Number of successful extensions: 379 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 319 Number of HSP's gapped (non-prelim): 109 length of query: 255 length of database: 21,341,249 effective HSP length: 103 effective length of query: 152 effective length of database: 21,246,798 effective search space: 3229513296 effective search space used: 3229513296 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 62 (28.5 bits)