TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|74553663|sp|Q6LX62.1|PSTK_METMP RecName: Full=L-seryl-tRNA(Sec) kinase; AltName: Full=O-phosphoseryl-tRNA(Sec) kinase; Short=PSTK (255 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850424|gb|ADNL01000179.1| Astrammina rara contig00189, who... 31 0.027 gi|330848102|gb|ADNL01002501.1| Astrammina rara contig02969, who... 22 9.7 gi|330848697|gb|ADNL01001906.1| Astrammina rara contig02264, who... 22 9.7 >gi|330850424|gb|ADNL01000179.1| Astrammina rara contig00189, whole genome shotgun sequence Length = 2213 Score = 30.8 bits (68), Expect = 0.027 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 6/68 (8%) Frame = -2 Query: 41 ESFPVWKESYEEFIRDSNNYLIKEALENKFSVIVDDTNY---YNSKRRDLMNIAKECDT- 96 + F VW + R N +L+ + N FS++ Y YNSK +++N + D Sbjct: 961 KGFRVWFMPHARDTRSGNAFLLVNRMTNGFSIVPTTITYRKKYNSKFYEVLNYNQPEDAA 782 Query: 97 --NYVTIY 102 N++ IY Sbjct: 781 P*NFLMIY 758 >gi|330848102|gb|ADNL01002501.1| Astrammina rara contig02969, whole genome shotgun sequence Length = 2042 Score = 22.3 bits (46), Expect = 9.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 3 IILTGLPSVGKSTF 16 I +TG+PS GKS F Sbjct: 1028 ITVTGIPSSGKSDF 1069 >gi|330848697|gb|ADNL01001906.1| Astrammina rara contig02264, whole genome shotgun sequence Length = 174 Score = 22.3 bits (46), Expect = 9.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 3 IILTGLPSVGKSTF 16 I +TG+PS GKS F Sbjct: 33 ITVTGIPSSGKSDF 74 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.315 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 262,948 Number of Sequences: 3231 Number of extensions: 2432 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 255 length of database: 483,365 effective HSP length: 72 effective length of query: 183 effective length of database: 250,733 effective search space: 45884139 effective search space used: 45884139 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)