TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000033_1.0 # Protein # Selenophosphate synthetase 2 (SPS2) # Homo sapiens # Complete (448 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330848434|gb|ADNL01002169.1| Astrammina rara contig02594, who... 25 3.7 gi|330847724|gb|ADNL01002879.1| Astrammina rara contig01283, who... 24 6.3 >gi|330848434|gb|ADNL01002169.1| Astrammina rara contig02594, whole genome shotgun sequence Length = 2535 Score = 24.6 bits (52), Expect = 3.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 327 QNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGR 359 Q + Q SF+ N+P+ A + A+S SGR Sbjct: 2256 QRVVTDQNTNDSFLCCNIPLFACVEALSIKSGR 2354 >gi|330847724|gb|ADNL01002879.1| Astrammina rara contig01283, whole genome shotgun sequence Length = 704 Score = 23.9 bits (50), Expect = 6.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 62 CKVPQEALLKLLAGLTRPDVRP 83 CKV L+K A +RP +RP Sbjct: 247 CKVCLTVLIKATAAPSRPSIRP 182 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 597,936 Number of Sequences: 3231 Number of extensions: 7194 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 448 length of database: 483,365 effective HSP length: 77 effective length of query: 371 effective length of database: 234,578 effective search space: 87028438 effective search space used: 87028438 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)