TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000048_1.0 # Protein # Selenophosphate synthetase 2 (SPS2) # Drosophila melanogaster # Complete (370 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850524|gb|ADNL01000079.1| Astrammina rara contig00082, who... 27 0.47 gi|330850357|gb|ADNL01000246.1| Astrammina rara contig00257, who... 25 3.0 gi|330849608|gb|ADNL01000995.1| Astrammina rara contig01161, who... 24 5.2 gi|330850437|gb|ADNL01000166.1| Astrammina rara contig00173, who... 23 6.7 >gi|330850524|gb|ADNL01000079.1| Astrammina rara contig00082, whole genome shotgun sequence Length = 9033 Score = 27.3 bits (59), Expect = 0.47 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 259 ITGFGLLGHANNLAQFQKEKVLFQINKLPIIKNVLKFSTLVGQSTKFR 306 ++ F LGHAN++ +V + + I+ V+ + STKFR Sbjct: 6140 VSRFSFLGHANSIGVHTHFEVKISFSLVSHIRAVISAHHTIPTSTKFR 6283 >gi|330850357|gb|ADNL01000246.1| Astrammina rara contig00257, whole genome shotgun sequence Length = 548 Score = 24.6 bits (52), Expect = 3.0 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +2 Query: 72 IQTVDFFYPMVNDPELLG-RIAL 93 I T F+ P++ +PELLG ++AL Sbjct: 368 IST*HFYVPLIKNPELLGFKVAL 436 >gi|330849608|gb|ADNL01000995.1| Astrammina rara contig01161, whole genome shotgun sequence Length = 348 Score = 23.9 bits (50), Expect = 5.2 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 10/76 (13%) Frame = -1 Query: 118 STSFSEKERDVVIGLVMKGFQNSLKANGYRNTPLI----------IRQLKINPWCIIGGI 167 + +FS+ +V+ L + F LKA +R PLI I LK N + + Sbjct: 309 AVAFSKIPSVLVVVLKFQEFSG*LKAVVFRKIPLISVTLLTSQEFIFWLKANAYPNVLNK 130 Query: 168 ATSVCRSEEIILPSNA 183 ++ S+E+I P A Sbjct: 129 LVTLLTSQELIFPLKA 82 >gi|330850437|gb|ADNL01000166.1| Astrammina rara contig00173, whole genome shotgun sequence Length = 308 Score = 23.5 bits (49), Expect = 6.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 304 KFRSGRSVETSGGLLICLPADAADKFCRD 332 +FR GR V S C P ++ CRD Sbjct: 243 RFRRGRGV*VSPHRTSCHPCSSSRSSCRD 157 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.319 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 548,566 Number of Sequences: 3231 Number of extensions: 6620 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of query: 370 length of database: 483,365 effective HSP length: 75 effective length of query: 295 effective length of database: 241,040 effective search space: 71106800 effective search space used: 71106800 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)