TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000037_1.0 # Protein # SECIS binding protein 2 (SBP2) # Homo sapiens # Complete (854 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330850544|gb|ADNL01000059.1| Astrammina rara contig00062, who... 28 0.85 gi|330848818|gb|ADNL01001785.1| Astrammina rara contig02119, who... 25 7.2 gi|330848917|gb|ADNL01001686.1| Astrammina rara contig02000, who... 25 7.2 gi|330850390|gb|ADNL01000213.1| Astrammina rara contig00223, who... 25 7.2 gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, who... 25 7.2 gi|330850421|gb|ADNL01000182.1| Astrammina rara contig00192, who... 25 7.2 gi|330850025|gb|ADNL01000578.1| Astrammina rara contig00644, who... 24 9.4 >gi|330850544|gb|ADNL01000059.1| Astrammina rara contig00062, whole genome shotgun sequence Length = 2381 Score = 27.7 bits (60), Expect = 0.85 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +3 Query: 24 VPRFAGLNVAWLESSEACVF------PSSAATYYPFVQEPP 58 V AGL+V+W+E C++ P S AT V+ PP Sbjct: 1638 VESLAGLSVSWIELPVLCIYI*FCRHPRSHATLPGIVRVPP 1760 >gi|330848818|gb|ADNL01001785.1| Astrammina rara contig02119, whole genome shotgun sequence Length = 241 Score = 24.6 bits (52), Expect = 7.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 312 LSAAPKNVTSMINLKTIASSADPKNVSIPSSEALSSDP 349 LS+ P + + NLK + P +PS+ L+S+P Sbjct: 44 LSSLPFTILHLFNLKVPSLKGTPSISILPSTLLLASNP 157 >gi|330848917|gb|ADNL01001686.1| Astrammina rara contig02000, whole genome shotgun sequence Length = 337 Score = 24.6 bits (52), Expect = 7.2 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 495 GRRMSQMKTPHNPLDSSAPLMKKGKQREIPKAK 527 G + TPH P ++ +KKG++R + K Sbjct: 266 GNMFANCWTPHYPTSGASLSLKKGQKRAVTDIK 168 >gi|330850390|gb|ADNL01000213.1| Astrammina rara contig00223, whole genome shotgun sequence Length = 2541 Score = 24.6 bits (52), Expect = 7.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 87 LHPYAYSPYTLDSTQNVYSVP 107 LHPY PY L S ++ Y+ P Sbjct: 808 LHPYDREPYWLLSGEDAYTSP 870 >gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, whole genome shotgun sequence Length = 6385 Score = 24.6 bits (52), Expect = 7.2 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -3 Query: 66 TEDMAFGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPS 117 T D + AST+P Y ++ + +P ++T + S YLY S Sbjct: 3338 TPDTSTDASTYPATYATTTPDAITISETPVISETTTTSITTTCSDYLYQLSS 3183 >gi|330850421|gb|ADNL01000182.1| Astrammina rara contig00192, whole genome shotgun sequence Length = 581 Score = 24.6 bits (52), Expect = 7.2 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -2 Query: 399 EPPRIEDAEEFPNLAVAS 416 +PP D+E++PNLAV++ Sbjct: 481 KPPLSGDSEKYPNLAVSA 428 >gi|330850025|gb|ADNL01000578.1| Astrammina rara contig00644, whole genome shotgun sequence Length = 2009 Score = 24.3 bits (51), Expect = 9.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 318 NVTSMINLKTIASSADPK 335 ++ S+ NL T+ SSADPK Sbjct: 100 SIXSIANLCTVISSADPK 153 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.311 0.128 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,143,985 Number of Sequences: 3231 Number of extensions: 13247 Number of successful extensions: 67 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of query: 854 length of database: 483,365 effective HSP length: 82 effective length of query: 772 effective length of database: 218,423 effective search space: 168622556 effective search space used: 168622556 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (24.3 bits)