TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000087_1.0 # Protein # SECIS binding protein 2 (SBP2) # Drosophila melanogaster # Complete (313 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330849694|gb|ADNL01000909.1| Astrammina rara contig01058, who... 27 0.65 gi|330849340|gb|ADNL01001263.1| Astrammina rara contig01488, who... 26 0.85 gi|330848344|gb|ADNL01002259.1| Astrammina rara contig02695, who... 25 1.9 gi|330847384|gb|ADNL01003219.1| Astrammina rara contig02818, who... 23 5.5 gi|330847707|gb|ADNL01002896.1| Astrammina rara contig01575, who... 23 5.5 gi|330850390|gb|ADNL01000213.1| Astrammina rara contig00223, who... 23 5.5 >gi|330849694|gb|ADNL01000909.1| Astrammina rara contig01058, whole genome shotgun sequence Length = 960 Score = 26.6 bits (57), Expect = 0.65 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 Query: 141 SKTPAPNNPSQAKTVHAIHSRRFRSYCDNCTRPRLKELSTQLLRDLDRFQKR 192 +KTPAP S T+H H +S PR + + T DRF+ R Sbjct: 959 TKTPAPR*MSDPTTIHHKHET*TKSTVIRRPSPRHQSVVTSSTLLCDRFRGR 804 >gi|330849340|gb|ADNL01001263.1| Astrammina rara contig01488, whole genome shotgun sequence Length = 228 Score = 26.2 bits (56), Expect = 0.85 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 74 VYKPKGKTRLDPKKKITRLKKSVRVYRTSKKAEREVAENDL 114 + KPK + R + K I RL+++ + SKK + +N L Sbjct: 148 IKKPKAEKRKERKPNIHRLREAAAENKFSKKLRSKKTKNKL 26 >gi|330848344|gb|ADNL01002259.1| Astrammina rara contig02695, whole genome shotgun sequence Length = 1454 Score = 25.0 bits (53), Expect = 1.9 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 155 VHAIHSRRFRSYCDNCTRPRLKELSTQLLR 184 +H F C NC PR++ T L R Sbjct: 740 MHTSRRSMFHGVCPNCCNPRVQHPKTTLSR 829 >gi|330847384|gb|ADNL01003219.1| Astrammina rara contig02818, whole genome shotgun sequence Length = 2919 Score = 23.5 bits (49), Expect = 5.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 116 GVPVVGQDINPNAIP 130 G+PVVGQ P AIP Sbjct: 1689 GLPVVGQTSLPQAIP 1733 >gi|330847707|gb|ADNL01002896.1| Astrammina rara contig01575, whole genome shotgun sequence Length = 340 Score = 23.5 bits (49), Expect = 5.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 261 FPLLRRELSYALQKRAQICCVAILDFDGANATYADL 296 FPLL R LS + ++C +A++ ADL Sbjct: 241 FPLLLRRLSLCMIITTEMCLIALIVKKQKRMVKADL 134 >gi|330850390|gb|ADNL01000213.1| Astrammina rara contig00223, whole genome shotgun sequence Length = 2541 Score = 23.5 bits (49), Expect = 5.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -1 Query: 5 IRRSRNQDVQDTAIKITPRSSKYKNQH 31 + S +Q + ++KITPR+ + N H Sbjct: 264 VATSHSQYLSTMSLKITPRTQHFDNIH 184 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.319 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 461,724 Number of Sequences: 3231 Number of extensions: 5708 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of query: 313 length of database: 483,365 effective HSP length: 74 effective length of query: 239 effective length of database: 244,271 effective search space: 58380769 effective search space used: 58380769 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)